[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57654.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:135 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->120 1s7iA PDBj 2e-08 35.2 %
:RPS:SCOP  26->126 1mwqA  d.58.4.7 * 2e-08 18.3 %
:HMM:SCOP  1->126 1s7iA_ d.58.4.9 * 5.3e-25 38.8 %
:RPS:PFM   73->103 PF03795 * YCII 4e-06 58.1 %
:HMM:PFM   15->108 PF03795 * YCII 2.8e-15 32.8 67/95  
:BLT:SWISS 69->131 Y369_RHIME 6e-07 44.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57654.1 GT:GENE BAD57654.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2995745..2996152 GB:FROM 2995745 GB:TO 2996152 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57654.1 LENGTH 135 SQ:AASEQ MAKYLLLKHYRGAPAAVNDVPMDRWTPEEIHAHVQYMNDFAARLEASGEFVDGQALAPEGMWVRSDGEGKPPVTDGPFAETKDLIAGWMIIDVDSQDRAVELAGELSAAPGAGGAPIHEWLEVRPFLTAPPTVTE GT:EXON 1|1-135:0| BL:SWS:NREP 1 BL:SWS:REP 69->131|Y369_RHIME|6e-07|44.8|58/100| BL:PDB:NREP 1 BL:PDB:REP 3->120|1s7iA|2e-08|35.2|108/124| RP:PFM:NREP 1 RP:PFM:REP 73->103|PF03795|4e-06|58.1|31/94|YCII| HM:PFM:NREP 1 HM:PFM:REP 15->108|PF03795|2.8e-15|32.8|67/95|YCII| RP:SCP:NREP 1 RP:SCP:REP 26->126|1mwqA|2e-08|18.3|82/100|d.58.4.7| HM:SCP:REP 1->126|1s7iA_|5.3e-25|38.8|116/124|d.58.4.9|1/1|Dimeric alpha+beta barrel| OP:NHOMO 44 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- --2-2--------------------1------11112142-112-2--------------111-321112---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------1----------------------------11-----------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 80.0 SQ:SECSTR ##EEEEEEEEcGGGccc##ccH#####HHHHHHHHHHHHHHHHHHHHTcEEEEEEcGGGcEEEEEcc#ccEEEEEccccccccEEEEEEEEEEccHHHHHHHHTTc##GGGGGcEEcccc############### DISOP:02AL 22-24, 133-135| PSIPRED cccEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHccEEEccccccccccEEEEEEcccEEEEEccccccccEEccEEEEEcccHHHHHHHHHHcccccccccccEEEEEEEEEcccccccccc //