[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57656.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:561 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57656.1 GT:GENE BAD57656.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2997469..2999154 GB:FROM 2997469 GB:TO 2999154 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57656.1 LENGTH 561 SQ:AASEQ MSCSITLIAVSVSALSAADPPAGERIEWVYPSTSSVPSVISSVIRRHLPLPASAGPRPPECDQLSYLRFRSAAGPEEAAHADRILVAQPGIFEGASAFESLARNTVAAAARQGAHLEFWALDRRSNCLEDHTGRLAGLRTGSLDVATAYYFGGAEIDGRRFAGFPVDGPAVAWLANQGLAQTLRDQYDLLRAELPDPAVRGRKVLCGGHSLGGLITGNFAEWDFDGDPATTDDAGHRQCAGYFALDTAVSADPAALMPQAELPDLPPAVAAVLAAGTGRVGTALPVLAAPAVINPETMNLLALAGLAAHLEPEGVDQIVARLPRNPNVDATLRVLLAQDHRAVLTGHPDIRTLHATNTAVLGAILDDNSQPFAFLQASTGFLAPGTPVGPKSFPLPTAAAAALPLGPALFGTAKKFAPTGFDPGTVYRWSDYDAVDPARFDATTPDSEITSVHELARDLCEPPLDFTEWYFPTRLTLDTATPGGPGIDRHRRYPDAATGAPTITFVAADGVGVRPPPETPGRVVDLPGYNHLDVVTAAAEQNDGRPETVSTQLAAFAVAPS GT:EXON 1|1-561:0| SEG 9->22|avsvsalsaadppa| SEG 31->44|pstssvpsvissvi| SEG 260->283|aelpdlppavaavlaagtgrvgta| SEG 300->310|llalaglaahl| SEG 393->413|fplptaaaaalplgpalfgta| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccEEEEEEEEEHHHHccccccccEEEEEccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHcccccHHHHcccEEEEEccccccHHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHcccEEEEEcccEEEEEEEEEcccEEcccEEEccccccccEEEHHcccHHHHHHHHHHHHHHccccHHHcccEEEEcccccccEEEccEEEEccccccccccccccHHHccEEEEccccccccHHcccccccccccHHHHHHHHccccccccHHHHHHcccEEccHHHHHHHHHHHHHHcccccHHHHHHHcccccccccEEEEEEEccccEEEEcccccEEEEccccEEEEEEEccccccEEEEEEcccccccccccccccccccHHHHHHccccHHHHHcHHHccccccccccEEEEcccccccccccccccccHHHHHHHHHHHHHccccccHHHHcccEEEEEEcccccccccHHHcccccccccccEEEEEEEccccccccccccccEEEccccccHHEEEEEHHcccccccHHHHEEEEEEEccc //