[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57658.1
DDBJ      :             putative oxidoreductase
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  40/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:396 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   79->270 1zx9A PDBj 2e-06 26.8 %
:RPS:PDB   26->117 3ctyA PDBj 6e-08 13.0 %
:RPS:PDB   153->361 2ebfX PDBj 2e-13 11.9 %
:RPS:SCOP  26->136 1fcdA1  c.3.1.5 * 2e-10 22.5 %
:RPS:SCOP  109->231 1d7yA2  c.3.1.5 * 1e-07 20.3 %
:HMM:SCOP  1->312 1gosA1 c.3.1.2 * 5.7e-29 29.7 %
:HMM:PFM   6->271 PF07992 * Pyr_redox_2 6e-30 37.2 183/202  
:BLT:SWISS 26->279 YJLD_BACSU 6e-10 33.9 %
:PROS 211->221|PS00435|PEROXIDASE_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57658.1 GT:GENE BAD57658.1 GT:PRODUCT putative oxidoreductase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3000114..3001304) GB:FROM 3000114 GB:TO 3001304 GB:DIRECTION - GB:PRODUCT putative oxidoreductase GB:PROTEIN_ID BAD57658.1 LENGTH 396 SQ:AASEQ MSGNIQVVVVGGGYAGVMAADRLTQRADVRVTVVNPRPRFVPRLRLHQLVGGTHDALVDYTDVLAEGVELVVDTVTRIDAQTSTVELAGGGTLGYDYLVYAVGSLAATPPVPGVAEFAYPLATFEAAQRLRSALLDTPTSAAVTVVGGGPTGIETAAELAEQGRAVTLVCGGTLAPYLHAKARRTARRYLTRLGVEVLEGPEATVTAVTRDTVELGGGHAVRSAITIWAAGFGVPDLAARSGLRTDAAGRLLTDETLTSVDDERIVAAGDSSAPSGLPFRMSAYAAGCLGAHAADTLLSRMAGRQPAPIDLSFSAMCISFGRTAGIFQPAHKDDTAMPIYFPGPVGKKLKEVSCEFSVKHLVTEARKPGSHKWMKDGKHRPAQLAARQQDAATPVA GT:EXON 1|1-396:0| BL:SWS:NREP 1 BL:SWS:REP 26->279|YJLD_BACSU|6e-10|33.9|251/392| PROS 211->221|PS00435|PEROXIDASE_1|PDOC00394| SEG 7->20|vvvvgggyagvmaa| SEG 137->152|tptsaavtvvgggptg| SEG 182->193|arrtarryltrl| SEG 283->294|ayaagclgahaa| BL:PDB:NREP 1 BL:PDB:REP 79->270|1zx9A|2e-06|26.8|183/453| RP:PDB:NREP 2 RP:PDB:REP 26->117|3ctyA|6e-08|13.0|92/304| RP:PDB:REP 153->361|2ebfX|2e-13|11.9|176/711| HM:PFM:NREP 1 HM:PFM:REP 6->271|PF07992|6e-30|37.2|183/202|Pyr_redox_2| RP:SCP:NREP 2 RP:SCP:REP 26->136|1fcdA1|2e-10|22.5|111/186|c.3.1.5| RP:SCP:REP 109->231|1d7yA2|1e-07|20.3|118/121|c.3.1.5| HM:SCP:REP 1->312|1gosA1|5.7e-29|29.7|290/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 54 OP:NHOMOORG 44 OP:PATTERN ----------------1--------------------------------------------------- ----1---------211----1--12-----1222231-------1--------------11--111212-----------------------------------------------------------------------------------11----1---------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------1------------------------------------------------------------------------------------1------------1-------1----1---11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------1-----1-1----------------------------------------------------------------------------------------------------- -----------------------1-------------------------1---1------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 332 STR:RPRED 83.8 SQ:SECSTR #####################HHTTHTTcccEEEcccccccccccccTTcTTcccHHHHHHHHHHHTcEEEcccEEEcccccEEEEETTccEEEEcEEEEcccEEEcccccTHHHHTcTTTEEcEcHHHcHHHHGGGGTTcEEEEEcccHHHEcHHHHccEEccccEEccHHHHHTccEEEEcccccEEEccccGGGcccccccccTTccccccccccEEEcccEEccccccccccHHHHHHHHHTTHHHHHHHHccccHHHHHTcHHHHHTccccTTcTEEEccccHHHHHHcTTHHHHHHHHHHHTTcEEcccEEEEEEEEETTTEEEEEEEEEEEEEETTEEE########EEETTGG################################### DISOP:02AL 1-3, 382-396| PSIPRED cccccEEEEEcccHHHHHHHHHHHHccccEEEEEccccccccccccHHHHcccHHHHccHHHHHHcccEEEEEEEEEEcccccEEEEccccEEEEcEEEEEcccEEccccccccccccEEEEcHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEccccEEEEEEEEEEcccccHHHHHHccccccccccEEEccccEEcccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHcccccccEEEcccEEEEEEccccEEEEEccccccccEEEEccHHHHHHHHHHHHHHHHHHHHHHccHHcHHHccccccccccccccccccccccc //