[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57664.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  116/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.30.5
:308 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   56->210 1snzB PDBj 2e-09 31.1 %
:RPS:PDB   20->302 3dcdA PDBj 1e-29 15.6 %
:RPS:SCOP  17->295 1lurA  b.30.5.4 * 1e-35 20.8 %
:HMM:SCOP  13->302 1z45A1 b.30.5.4 * 1.2e-51 33.6 %
:RPS:PFM   56->277 PF01263 * Aldose_epim 9e-20 38.5 %
:HMM:PFM   13->297 PF01263 * Aldose_epim 9.5e-35 27.3 278/301  
:BLT:SWISS 9->294 YIHR_ECOLI 6e-39 37.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57664.1 GT:GENE BAD57664.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3007471..3008397 GB:FROM 3007471 GB:TO 3008397 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57664.1 LENGTH 308 SQ:AASEQ MPDTAPTATGRSIVLDAHRVRAEIGTVAAVLRSLTVAGTALTEPISAAAPPPLGCGIVLVPWPNRVRDARWTLDGAPQHLDITEPARGNAIHGLLRNTEYSVRERTGDSVTLAALIPPQHGWPFLLDTTVGYTLRSDGLTVVHTATNHGDRPAPWAVGAHPYLRVGDTPVGELVLTVHADTWFDVDERMNPTGEHPVDGTDRDLRDGVRVDALDLDTAFGAVTPRDGVAARLTTPGGATVDLRYGADWGYLQVFTPRTFPRPDGPGLAIAVEPMTAPPDALNSGRGLHWLEPGETTARTWEIVHTPGR GT:EXON 1|1-308:0| BL:SWS:NREP 1 BL:SWS:REP 9->294|YIHR_ECOLI|6e-39|37.1|278/308| BL:PDB:NREP 1 BL:PDB:REP 56->210|1snzB|2e-09|31.1|151/342| RP:PDB:NREP 1 RP:PDB:REP 20->302|3dcdA|1e-29|15.6|263/292| RP:PFM:NREP 1 RP:PFM:REP 56->277|PF01263|9e-20|38.5|213/295|Aldose_epim| HM:PFM:NREP 1 HM:PFM:REP 13->297|PF01263|9.5e-35|27.3|278/301|Aldose_epim| GO:PFM:NREP 2 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01263|IPR008183| GO:PFM GO:0016853|"GO:isomerase activity"|PF01263|IPR008183| RP:SCP:NREP 1 RP:SCP:REP 17->295|1lurA|1e-35|20.8|274/325|b.30.5.4| HM:SCP:REP 13->302|1z45A1|1.2e-51|33.6|283/0|b.30.5.4|1/1|Galactose mutarotase-like| OP:NHOMO 148 OP:NHOMOORG 129 OP:PATTERN ------1111111111-1--------------------------------------------21---- --212-1----11---1-------------------111111---11-122-322-11--1121112---11111222---------------1-----------1-1----------------------------------------1----------------------------------111-----1-1-----------------11-1-----------------1-----------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------111-----1---------------------------11---------------------------------------------1--2-11----1121-----1112------22-----------------------------------------------------------------------------------------------------------------------------------------1-----111-1---1--1-111-111-1-111111---------1111111111111111----111--------------------------------------------------------------------------------------------------1-------------------------------------------------------------------1-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 295 STR:RPRED 95.8 SQ:SECSTR #####cEEEcccEEETEEEEEEEEETcTTEEEEEEETTTccccccccTTTccccccEEEcccccccGGGEEEETTEEEEcccccTT##ccTTccGGGcccEEEEEETTEEEEEEEccHHHHccccEEEEEEEEETTccEEEEEEEEEEcccccEEcEEEccEEEcccTTGGGEEEEEccccEEEccEETTEEcGEEGGcEEEcTTccEEcccGGGTTccEEEEccccEEEEEEETTccEEEEEEEETccEEEEEccHHcccccccccEEEEEEEEcccccTTGGcTTEEEcTTcEEEEEEEE###### DISOP:02AL 1-2| PSIPRED ccccccccccEEEEEEcccEEEEEEccccEEEEEEEccccEEccccccccccccccEEEEEEEEEEcccEEEEccEEEEEccccccccccccccEEccEEEEEEEcccEEEEEEEccccccccEEEEEEEEEEEEccEEEEEEEEEEccccEEEEEEcccEEEEEccccccEEEEEEEccEEEEEccccccccccccccccccccccEEcccccccEEEEEccccccEEEEEEcccccEEEEEEEcccccEEEEcccccccccccccEEEEEEccccccccccccccEEEccccEEEEEEEEEEEEcc //