[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57666.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:55 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->15 PF10578 * SVS_QK 0.00032 66.7 9/12  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57666.1 GT:GENE BAD57666.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3009947..3010114) GB:FROM 3009947 GB:TO 3010114 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57666.1 LENGTH 55 SQ:AASEQ MPIKYRQRKSFGPLKLNFTQSGLSSWSIKIGPWSWNSRTRRNSVDLPGPLSWRQR GT:EXON 1|1-55:0| HM:PFM:NREP 1 HM:PFM:REP 7->15|PF10578|0.00032|66.7|9/12|SVS_QK| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-----------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 54-55| PSIPRED cccEEccccccccEEEEEEccccEEEEEEEccccccccccccccccccccccccc //