[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57667.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:63 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->61 PF11272 * DUF3072 2e-10 67.3 %
:HMM:PFM   5->61 PF11272 * DUF3072 6e-36 70.2 57/57  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57667.1 GT:GENE BAD57667.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3010188..3010379) GB:FROM 3010188 GB:TO 3010379 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57667.1 LENGTH 63 SQ:AASEQ MVQPNPEKDPQEWTTGDEPMTGPQESYLHTLAQEAGEQVPEGLTKAQASRLIDELQQRTGRGE GT:EXON 1|1-63:0| RP:PFM:NREP 1 RP:PFM:REP 7->61|PF11272|2e-10|67.3|55/57|DUF3072| HM:PFM:NREP 1 HM:PFM:REP 5->61|PF11272|6e-36|70.2|57/57|DUF3072| OP:NHOMO 25 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- ---------------------1----------11111-------1----11----1-------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11----1---------------11111111-----------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 55-56, 58-63| PSIPRED ccccccccccHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //