[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57668.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  46/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:82 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->54 PF06906 * DUF1272 8e-08 55.6 %
:HMM:PFM   1->54 PF06906 * DUF1272 1.9e-24 55.6 54/57  
:BLT:SWISS 1->71 Y2474_RHIME 2e-12 51.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57668.1 GT:GENE BAD57668.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3010479..3010727) GB:FROM 3010479 GB:TO 3010727 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57668.1 LENGTH 82 SQ:AASEQ MLRMKSRCEPCGATLRPDGEAWICSYECTYCPTCHTGLDSCPNCAGELVPRPRRTTGAAQIATRLPARLARRIGLGTTRPSP GT:EXON 1|1-82:0| BL:SWS:NREP 1 BL:SWS:REP 1->71|Y2474_RHIME|2e-12|51.5|68/84| RP:PFM:NREP 1 RP:PFM:REP 1->54|PF06906|8e-08|55.6|54/56|DUF1272| HM:PFM:NREP 1 HM:PFM:REP 1->54|PF06906|1.9e-24|55.6|54/57|DUF1272| OP:NHOMO 46 OP:NHOMOORG 46 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1----------------1--------------------------------------------------------------------------------------------------------------------------------------------11-1111-1111111--------1--------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1--------------------------------1----111--1-11---1---------------------------------------------------------11-1-------------------1---------11-1-----------11--------------------------------------------------------------------------------------1------1------------------------------------11----------------------------------1-11--------------------------------------------1-------------------------------------------1-1-----1------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 77-82| PSIPRED ccccccccccccccccccccEEEEEEEcccccHHHcccccccccccccccccccccHHHHHHHHccHHHHHHHccccccccc //