[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57669.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->143 3dkzB PDBj 1e-06 36.8 %
:RPS:PDB   15->139 3e1eB PDBj 6e-14 21.3 %
:RPS:SCOP  23->143 1zkiA1  d.38.1.5 * 6e-14 22.0 %
:HMM:SCOP  16->143 1zkiA1 d.38.1.5 * 1.7e-27 39.2 %
:HMM:PFM   58->132 PF03061 * 4HBT 7.8e-12 31.5 73/79  
:BLT:SWISS 10->132 Y1336_HALSA 5e-08 28.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57669.1 GT:GENE BAD57669.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3010731..3011165) GB:FROM 3010731 GB:TO 3011165 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57669.1 LENGTH 144 SQ:AASEQ MNKEQLQQMASGGTELMRLFVPQSPFVRLLGVRIEELTDDEAALRLPWRPELATVEDMVHGGAIAALADMTVMAAAWCGRELPGELRGVTTSLAMEFLQPARAEDLIGRGRPLRRGATLTAREVDIVTASGTHVAKALANYKVG GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 10->132|Y1336_HALSA|5e-08|28.7|122/151| SEG 63->76|aiaaladmtvmaaa| BL:PDB:NREP 1 BL:PDB:REP 25->143|3dkzB|1e-06|36.8|106/120| RP:PDB:NREP 1 RP:PDB:REP 15->139|3e1eB|6e-14|21.3|122/140| HM:PFM:NREP 1 HM:PFM:REP 58->132|PF03061|7.8e-12|31.5|73/79|4HBT| RP:SCP:NREP 1 RP:SCP:REP 23->143|1zkiA1|6e-14|22.0|118/126|d.38.1.5| HM:SCP:REP 16->143|1zkiA1|1.7e-27|39.2|125/0|d.38.1.5|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 17 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- --------------21111-1---11111111----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 97.2 SQ:SECSTR ####cGGGTcccHHHHHHHHHHTcHHHHHHTcEEEEccTTccEEEEEccGGGccTTccccHHHHHHHHHHHHHHHHHHHTTcccccEEEEEEEEEEEcccccccEEEEEEEEEEccccEEEEEEEEEEEccccEEEEEEEEEEc DISOP:02AL 1-11| PSIPRED ccccccccccccHHHHHHHHHccccHHHHcccEEEEEEccEEEEEEEEcHHHHccccEEEHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEccccccEEEEEEEEEEcccEEEEEEEEEEEccccEEEEEEEEEEEc //