[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57670.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  104/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:195 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->167 2hytA PDBj 5e-13 34.8 %
:RPS:PDB   12->170 3br5E PDBj 9e-17 17.7 %
:RPS:SCOP  5->81 1rktA1  a.4.1.9 * 1e-13 15.6 %
:RPS:SCOP  80->165 2id3A2  a.121.1.1 * 6e-05 16.3 %
:HMM:SCOP  1->88 1t33A1 a.4.1.9 * 2.4e-17 31.0 %
:HMM:SCOP  83->196 1vi0A2 a.121.1.1 * 1.8e-10 33.6 %
:RPS:PFM   16->62 PF00440 * TetR_N 3e-04 34.0 %
:HMM:PFM   16->62 PF00440 * TetR_N 1.8e-16 40.4 47/47  
:HMM:PFM   69->167 PF08359 * TetR_C_4 2.7e-05 22.2 99/133  
:BLT:SWISS 7->70 TTGW_PSEPU 1e-09 42.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57670.1 GT:GENE BAD57670.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3011218..3011805 GB:FROM 3011218 GB:TO 3011805 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57670.1 LENGTH 195 SQ:AASEQ MTTLRQAQAQATRERLIEVATRLFAADGYAAVTTTTLSEAAGMTRGALYHHFANMGEVMAAVLARSERALVERVAHALDEHPEPRAKFLALGPSLLRVLAEDPTTQRIVFLEAPAALGWTRWRAIDEGRSLALIAGLLTELRERGQLAEGVDPHLTAQLLLGAINEAGMRVAATDGRDRAAAASQLTLLCRGLLA GT:EXON 1|1-195:0| BL:SWS:NREP 1 BL:SWS:REP 7->70|TTGW_PSEPU|1e-09|42.2|64/134| SEG 172->183|aatdgrdraaaa| BL:PDB:NREP 1 BL:PDB:REP 5->167|2hytA|5e-13|34.8|155/188| RP:PDB:NREP 1 RP:PDB:REP 12->170|3br5E|9e-17|17.7|158/186| RP:PFM:NREP 1 RP:PFM:REP 16->62|PF00440|3e-04|34.0|47/47|TetR_N| HM:PFM:NREP 2 HM:PFM:REP 16->62|PF00440|1.8e-16|40.4|47/47|TetR_N| HM:PFM:REP 69->167|PF08359|2.7e-05|22.2|99/133|TetR_C_4| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 2 RP:SCP:REP 5->81|1rktA1|1e-13|15.6|77/81|a.4.1.9| RP:SCP:REP 80->165|2id3A2|6e-05|16.3|86/123|a.121.1.1| HM:SCP:REP 1->88|1t33A1|2.4e-17|31.0|87/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 83->196|1vi0A2|1.8e-10|33.6|113/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 143 OP:NHOMOORG 105 OP:PATTERN -------------------------------------------------------------------- ----1---------43211-1-1111111111-11142-1-21--1-------1--------1-111---------------------------------------------------------------------111--------------------------------------------1-----------------------1------------1----------1---------------------------------------------------------------------------------1-------------------------------------1------------------------1111-------1-------1------------1----------23--11-1223312111---------11-2-------------12---------------------------------1--------------------21--------21-----111-----1------------1-------------1----------1-----1------1----2---------------1------------------2--1--------------1---------------------11--2----------------------------------11-----------------------------------------------------------------------------1--------33231111-112-----------------------------22----------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 185 STR:RPRED 94.9 SQ:SECSTR ####ccccGGGcHHHHHHHHHHHHHHHTTTcccHHHHHHHTTccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHccccTTTTHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHTTTccccTccHHHHHHHHHHHHHHHHHTHHHHHcTTTTcHHHHHHHH###### DISOP:02AL 1-15| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcc //