[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57671.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  461/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.37.1
:337 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   132->312 3bp1B PDBj 9e-17 6.6 %
:RPS:SCOP  216->318 2rc3A1  d.37.1.1 * 7e-09 20.4 %
:HMM:SCOP  211->270 1pvmA2 d.37.1.1 * 6.2e-05 43.1 %
:HMM:SCOP  271->329 1pbjA2 d.37.1.1 * 1.8e-08 33.9 %
:RPS:PFM   65->200 PF01595 * DUF21 6e-18 43.4 %
:HMM:PFM   8->200 PF01595 * DUF21 1.5e-46 37.1 178/183  
:HMM:PFM   230->271 PF00571 * CBS 1.1e-06 38.1 42/57  
:HMM:PFM   277->330 PF00571 * CBS 4.8e-14 38.9 54/57  
:BLT:SWISS 62->317 Y1842_MYCTU 5e-24 33.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57671.1 GT:GENE BAD57671.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3011839..3012852) GB:FROM 3011839 GB:TO 3012852 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57671.1 LENGTH 337 SQ:AASEQ MDDPWVVLAATVGLIAASAFFVAVEFALIAARRHRLEDAAPRSRSARAALRSASELSVLLAGSQLGITVCTLALGASTKPAVHHWLTPAFENWGAPLWLADVAGFVLALVIVTFLHLVVGEMAPKSWAIAHPEKSATLLAIPMRAFMWLTRPLIVRLNQVANWCLRKVGVDPVDQVGSGQDPDALRHLVEHSATVGTLDERYHGHLVSALELSALTVGDMVPSGADPSGVSPDADAEQIAETARRTGHLRLLVGAAGQVDGVVHVRDALRAEPGVTAARLMRPALTLDTATAVYEALRIMRETRNHLAVVTDGDRVVGLITLADLLARLLPTADAAA GT:EXON 1|1-337:0| BL:SWS:NREP 1 BL:SWS:REP 62->317|Y1842_MYCTU|5e-24|33.1|239/455| TM:NTM 3 TM:REGION 7->29| TM:REGION 58->80| TM:REGION 99->121| SEG 16->27|aasaffvavefa| SEG 39->61|aaprsrsaraalrsaselsvlla| SEG 319->336|litladllarllptadaa| RP:PDB:NREP 1 RP:PDB:REP 132->312|3bp1B|9e-17|6.6|181/250| RP:PFM:NREP 1 RP:PFM:REP 65->200|PF01595|6e-18|43.4|122/184|DUF21| HM:PFM:NREP 3 HM:PFM:REP 8->200|PF01595|1.5e-46|37.1|178/183|DUF21| HM:PFM:REP 230->271|PF00571|1.1e-06|38.1|42/57|CBS| HM:PFM:REP 277->330|PF00571|4.8e-14|38.9|54/57|CBS| RP:SCP:NREP 1 RP:SCP:REP 216->318|2rc3A1|7e-09|20.4|103/127|d.37.1.1| HM:SCP:REP 211->270|1pvmA2|6.2e-05|43.1|58/78|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 271->329|1pbjA2|1.8e-08|33.9|59/61|d.37.1.1|2/2|CBS-domain| OP:NHOMO 758 OP:NHOMOORG 472 OP:PATTERN ------------------------2222132-------------1--1-------------------- 111-322444422222222-25--2222222-44444244142443325322644222--2231323488211111111-2-2-----111--------1-----112-1-----------------1----1-11--------1112213321111------21-32221------------312------244444443444444442-443444521111212222224321111111111111111122----11-------1111--1---1-------------------------------------------------12-----------111------1------12211-1--------1--2-----1-----11-1122-22221----------2-112113112-1-111132222311---11-12-------11111111-11--111---11----------1111--11111111-11111-----1112212111111221111-1212------11-1-1211----1----1-111---------1---------1-----------------1121221-1111-111111111111111-----11-111--11---11111112----11---11---1---------1111--11--1111111--111111111-11--1--1111-1-11----------------1111--11--1-------------11-----2222-1-1-111-1-1-----111------1---2-111111112111121111111-11-1-111111111111--1-222222211111------1111----------1-11--------------------------------112 --------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 187 STR:RPRED 55.5 SQ:SECSTR ###################################################################################################################################cEEEEEEEEEEEEEEcTTccEEEEEEEEEEETTccEEEcHHHHHHTTTTcccccHHHHHHHHHHHHHHHHTcccEEEEEEGGGGTTcccccccEEccccccccccccccGGGGTTcEEEEEEEEEEEEEEEcccEEEEEEEEEEcHHHHHccccHHHHHHHHHHHHHHTcccEEEEEEEEcTccEEE################### DISOP:02AL 35-50, 172-184, 336-337| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHccccHHHHHHHHHHccccccccHHHHHHHHHHHHHcccEEEccccccccEEEEcccccHHHHHHHHHHccccEEEEEccccEEEEEEHHHHHcccccccHHHHccccEEEcccccHHHHHHHHHHccccEEEEEccccEEEEEEHHHHHHHHcccccccc //