[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57672.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  17/68 : Bacteria  832/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
d.145.1d.37.1
:461 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   311->338 3i8nA PDBj 2e-05 60.7 %
:BLT:PDB   350->438 2p3hA PDBj 5e-14 37.1 %
:RPS:PDB   136->342 3bp1B PDBj 1e-22 6.8 %
:RPS:PDB   350->406 3dedB PDBj 2e-05 32.7 %
:RPS:SCOP  201->344 2ooxE1  d.37.1.1 * 8e-12 12.5 %
:RPS:SCOP  350->406 2p3hA1  d.145.1.4 * 6e-11 42.1 %
:HMM:SCOP  215->274 1pvmA2 d.37.1.1 * 1.2e-06 29.3 %
:HMM:SCOP  275->355 1pvmA2 d.37.1.1 * 6e-07 25.6 %
:RPS:PFM   21->202 PF01595 * DUF21 1e-11 29.2 %
:RPS:PFM   352->419 PF03471 * CorC_HlyC 5e-07 39.7 %
:HMM:PFM   10->205 PF01595 * DUF21 9.2e-45 34.8 181/183  
:HMM:PFM   353->445 PF03471 * CorC_HlyC 8e-22 41.0 78/81  
:HMM:PFM   224->274 PF00571 * CBS 3e-07 31.2 48/57  
:HMM:PFM   288->335 PF00571 * CBS 6.8e-07 31.2 48/57  
:BLT:SWISS 24->407 Y1842_MYCTU 3e-54 34.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57672.1 GT:GENE BAD57672.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3012845..3014230) GB:FROM 3012845 GB:TO 3014230 GB:DIRECTION - GB:PRODUCT putative membrane protein GB:PROTEIN_ID BAD57672.1 LENGTH 461 SQ:AASEQ MLTVLGIALGILVVLAITALTGYFVAQEFAYMAVDRSRLRARAEAGDAAAARALTVTRRTSFMLSGAQLGITVTGLLVGYVAEPLIGSGFGDLLGGVGVPTAVGVAVGTVLAVAFSTVVQMVFGELFPKNLAIARPEPVARWLARSTTLYLRLFGWLITLFDASSNLLLRLVRIEPVHDVEHSATPRDLVHIVAESRDTGELPAELSALLDRILDFPTRTAEHAMIPRSRVDYVGAGEPVARVLARMSAGHTRYPVVGDSADDLRGVVHLHDLLDDRETGTAGSRCRPAVLVPTTLPLPDVLARLGSAGEEMALVIDEYGGFAGVVTIEDMAEELVGEIADEHDTAIETEVVTVDGDGWLIRGDVHLDEVRRTLGHALPDGDYETLAGLVITEYGGLPEVGTTVAITLPPDPAELIMADPPPPRTLLAEVRAVDKHVPASVRVSVRVEAAAGQPERENRDG GT:EXON 1|1-461:0| BL:SWS:NREP 1 BL:SWS:REP 24->407|Y1842_MYCTU|3e-54|34.0|382/455| TM:NTM 4 TM:REGION 3->25| TM:REGION 64->86| TM:REGION 98->120| TM:REGION 139->161| SEG 2->20|ltvlgialgilvvlaital| SEG 38->60|rlraraeagdaaaaraltvtrrt| SEG 85->114|ligsgfgdllggvgvptavgvavgtvlava| SEG 288->303|pavlvpttlplpdvla| SEG 439->451|asvrvsvrveaaa| BL:PDB:NREP 2 BL:PDB:REP 311->338|3i8nA|2e-05|60.7|28/118| BL:PDB:REP 350->438|2p3hA|5e-14|37.1|89/98| RP:PDB:NREP 2 RP:PDB:REP 136->342|3bp1B|1e-22|6.8|207/250| RP:PDB:REP 350->406|3dedB|2e-05|32.7|55/83| RP:PFM:NREP 2 RP:PFM:REP 21->202|PF01595|1e-11|29.2|168/184|DUF21| RP:PFM:REP 352->419|PF03471|5e-07|39.7|68/81|CorC_HlyC| HM:PFM:NREP 4 HM:PFM:REP 10->205|PF01595|9.2e-45|34.8|181/183|DUF21| HM:PFM:REP 353->445|PF03471|8e-22|41.0|78/81|CorC_HlyC| HM:PFM:REP 224->274|PF00571|3e-07|31.2|48/57|CBS| HM:PFM:REP 288->335|PF00571|6.8e-07|31.2|48/57|CBS| RP:SCP:NREP 2 RP:SCP:REP 201->344|2ooxE1|8e-12|12.5|144/179|d.37.1.1| RP:SCP:REP 350->406|2p3hA1|6e-11|42.1|57/98|d.145.1.4| HM:SCP:REP 215->274|1pvmA2|1.2e-06|29.3|58/78|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 275->355|1pvmA2|6e-07|25.6|78/78|d.37.1.1|2/2|CBS-domain| OP:NHOMO 2038 OP:NHOMOORG 861 OP:PATTERN ------------------------23322331-----------12122---11-------------12 2121413655433333333-35--2333333-55555255253543437443756233--444153359932222222112-2121221112-322---223122423-11111111111----221111122121222221112213412222211-1-11-22132332111-1--11---32311----344444443444444442-4435445322224333333343211111111111111111221-112211-1-112222211-1121111111111111111111111111111111111111111111111-22231112222212113312222-122122-13311-11-------11241-322312122233333323333322222222223-2232252323312222444444332-1223232322222222222222221233311222222111122122222222221112-22221322233333332222233222222223223333122222233333223222232132311111112223211111123312232312222212222233231211111111111111111111-----22443122222113222222622211332122--332221--22254333455555555554-4555555555455555555555434435555445444555555455555552-4434433434441121111113333212123333333333223323333322221334444244423333243433232332323223222222322233333333322222213111111122221222232111----------------------111111-111112 ------------------------------------------------------------------------------------------------------------2-------------------------------------------------2----------------1---7-----41-1-211-2---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 299 STR:RPRED 64.9 SQ:SECSTR #######################################################################################################################################cEEEEEEEEEEEEEEcTTccEEEEEEEEEEETTccEEEcHHHHHHTTTTcccccHHHHHHHHHHHHHHHHTcccEEEEEEGGGGTTcccccccEEccccccccccccccGGGGTcEEEEEEEEEEEEEEEEEcccEEEEHHHHHHHHTTTTccccHHHHHHHHHHHHHHTcccEEEEEEEEcccTTEEEEEEEEcccccccccccTcccG####cEEEcTTccEEEETTccHHHHHHHHTccccGcccccHHHHHHHHHcccccTTcEEEEEccccGGGGTTcccccccEEEEEEEEEETTEE####################### DISOP:02AL 40-50, 178-186, 433-461| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccEEEEEEEcccEEEEEcccccHHHHHHHHHccccEEEEEEcccccEEEEEEHHHHHcccccccHHHHccccEEEcccccHHHHHHHHHHcccEEEEEEEccccEEEEEEHHHHHHHHHccccccccccccHHHEEEcccEEEEEccccHHHHHHHHcccccccccccHHHHHHHHHHcccccccEEEEEEccccEEEEEEEEcccEEEEEEEEEccccccHHHHHHccccccccccccccccc //