[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57674.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:239 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   169->220 2cyeD PDBj 3e-04 19.2 %
:RPS:SCOP  169->222 1yocA1  d.38.1.5 * 2e-04 7.4 %
:HMM:SCOP  97->239 1q4tA_ d.38.1.5 * 5e-10 20.3 %
:HMM:PFM   183->225 PF03061 * 4HBT 0.00023 25.6 43/79  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57674.1 GT:GENE BAD57674.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3015555..3016274) GB:FROM 3015555 GB:TO 3016274 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57674.1 LENGTH 239 SQ:AASEQ MTNSTTTTLTLSAAENALPGMSNGGFACGAFAGLVGGTATVVLRHGVPLAVPLTATGDGTKAAVTHGDTLLATAAAVEPFVLEPPVRASMDQAEHARRSHPMRGIEHPLSDCVVCGPDRDDGLRVTSGPLPGHPDVLASPFVPTERFAVAGVVRAAAVWGALDCPSYPAAAMRERRFCLLGSLTAHQRRPIEVGEELICLGWTLDAGNRSVRTASAIIDGSGAVVASARAVWVELRRQP GT:EXON 1|1-239:0| SEG 2->18|tnsttttltlsaaenal| SEG 148->161|avagvvraaavwga| SEG 223->233|avvasaravwv| RP:PDB:NREP 1 RP:PDB:REP 169->220|2cyeD|3e-04|19.2|52/122| HM:PFM:NREP 1 HM:PFM:REP 183->225|PF03061|0.00023|25.6|43/79|4HBT| RP:SCP:NREP 1 RP:SCP:REP 169->222|1yocA1|2e-04|7.4|54/145|d.38.1.5| HM:SCP:REP 97->239|1q4tA_|5e-10|20.3|138/0|d.38.1.5|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1---------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 54 STR:RPRED 22.6 SQ:SECSTR ########################################################################################################################################################################TcccGGGGGGEEEEEEEEEcccccTTccEEEEEEEEEEcccEEEEEEEEETTcH################# DISOP:02AL 1-3, 92-101, 238-239| PSIPRED ccccEEEEEEEcHHHcccccccccHHHHHHHHHHcccEEEEEEcccccccccEEEcccccEEEEEccccEEEEccccccEEEcccccccHHHHHHHHccccccccccccccEEEEcccccccEEEEEcccccccccEEEEccccHHHcccccHHHHHHHHHHccccHHHHccccccHHEEEEEEEEEEccccccccEEEEEEEEEcccEEEEEEEEEEcccccEEEEEEEEEEEEcccc //