[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57677.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  74/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.15.3
:251 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   6->77 3biiD PDBj 3e-05 22.4 %
:RPS:SCOP  6->77 2hj1A1  d.15.3.4 * 5e-05 23.4 %
:RPS:PFM   99->238 PF01927 * DUF82 6e-22 40.7 %
:HMM:PFM   98->240 PF01927 * DUF82 3e-44 40.6 143/147  
:BLT:SWISS 164->238 MUT7_HUMAN 5e-04 39.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57677.1 GT:GENE BAD57677.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3017514..3018269) GB:FROM 3017514 GB:TO 3018269 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57677.1 LENGTH 251 SQ:AASEQ MTASGIELRLYAELNDFLPPQDRQDALWRPVRPHQTVKDIVEAAGVPHTEIDLLLVNGESVGFEHHPRPGDRLAAYPMFESLDISGLTRVRPHPLREPRMLIDVNLGGLARLLRLMGQDVRCDFDATDARLAEISAEDHRILLTRDRGLLARRIVSHGVYVRADRPFEQIVEVIGRLDLADQLAPFTRCLRCGAVLADVAKDEIVHELSPGTRENYDTFRRCTGCGRIYWAGAHQRRLDDLVTQILAAVRR GT:EXON 1|1-251:0| BL:SWS:NREP 1 BL:SWS:REP 164->238|MUT7_HUMAN|5e-04|39.7|63/100| SEG 106->115|lgglarllrl| RP:PDB:NREP 1 RP:PDB:REP 6->77|3biiD|3e-05|22.4|67/80| RP:PFM:NREP 1 RP:PFM:REP 99->238|PF01927|6e-22|40.7|140/145|DUF82| HM:PFM:NREP 1 HM:PFM:REP 98->240|PF01927|3e-44|40.6|143/147|DUF82| RP:SCP:NREP 1 RP:SCP:REP 6->77|2hj1A1|5e-05|23.4|64/77|d.15.3.4| OP:NHOMO 83 OP:NHOMOORG 81 OP:PATTERN 11--1-----------------------------------------------------111------- --1------------1111-1---1-11111-----1-11--------------------------11111-----------1--------------------------------------------------------1111--1-1--11-----------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------1----------------------------------------------------------------------------------------------------------------------------------1111-1-----11111111111-11111--111-------1-----21--------------11---1---1------------------1--11--------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------1----1-1111-- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 26.7 SQ:SECSTR #####EEEEEcHHHHHHHcccEEEEcc#####ccccHHHHHHHHHTTcHHHHHEEETTEEccTTccccTTcEEEEEc############################################################################################################################################################################## DISOP:02AL 1-2, 249-251| PSIPRED ccccEEEEEEcccccccccccccccEEEEcccccccHHHHHHHcccccccEEEEEEccEEcccccccccccEEEEEEHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHccEEEEcccccHHHHHHHHHHcccEEEEccHHHHHHHHcccEEEEEcccHHHHHHHHHHHccccccccHHHHHHHcccEEEEccHHHHHHHccHHHHHcccEEEEEccccEEEccccHHHHHHHHHHHHHHHccc //