[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57680.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.6d.110.2
:314 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   263->305 2rnjA PDBj 8e-05 46.5 %
:RPS:PDB   241->310 3cloA PDBj 4e-11 21.4 %
:RPS:SCOP  263->310 1a04A1  a.4.6.2 * 2e-09 39.6 %
:HMM:SCOP  29->170 1mc0A2 d.110.2.1 * 6.8e-07 26.4 %
:HMM:SCOP  229->315 1p4wA_ a.4.6.2 * 4.4e-18 39.1 %
:RPS:PFM   263->305 PF00196 * GerE 2e-05 48.8 %
:HMM:PFM   250->305 PF00196 * GerE 1.2e-16 41.1 56/58  
:HMM:PFM   92->143 PF03472 * Autoind_bind 9.3e-06 32.0 50/149  
:BLT:SWISS 263->310 YXJL_BACSU 1e-05 43.8 %
:PROS 265->292|PS00622|HTH_LUXR_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57680.1 GT:GENE BAD57680.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3020758..3021702 GB:FROM 3020758 GB:TO 3021702 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57680.1 LENGTH 314 SQ:AASEQ MSESAVRARLAAALELRDAAAGSPVGEPLRQQAARLLFALRRVVPYDHAALSIPDPVTGEHTTYTNFGYSTPTLDLINDAMPDMELYDELRETRLPVLLHDVDRRRRRGVVFDTIRRNGFRDGLSHCLYSPHGRYLGMLNLSTYTPLDEHTLALTTLVSDALAAAVDPLRPVNGAAIALGAGEEALLIDLDGTPRPLTAGACTDLAAALVGRLPAPSATVIHRAQVHEVRVDEVRGGTLLRHRPVPPPAGLTLRELEVLELLAQGAANTEIARALRIGASTVATHVEAILRRTGSPNRTAAAVYATRIGLCRSW GT:EXON 1|1-314:0| BL:SWS:NREP 1 BL:SWS:REP 263->310|YXJL_BACSU|1e-05|43.8|48/218| PROS 265->292|PS00622|HTH_LUXR_1|PDOC00542| SEG 5->21|avrarlaaalelrdaaa| SEG 29->42|lrqqaarllfalrr| SEG 94->117|rlpvllhdvdrrrrrgvvfdtirr| SEG 174->188|gaaialgageealli| SEG 251->262|ltlrelevlell| BL:PDB:NREP 1 BL:PDB:REP 263->305|2rnjA|8e-05|46.5|43/67| RP:PDB:NREP 1 RP:PDB:REP 241->310|3cloA|4e-11|21.4|70/249| RP:PFM:NREP 1 RP:PFM:REP 263->305|PF00196|2e-05|48.8|43/57|GerE| HM:PFM:NREP 2 HM:PFM:REP 250->305|PF00196|1.2e-16|41.1|56/58|GerE| HM:PFM:REP 92->143|PF03472|9.3e-06|32.0|50/149|Autoind_bind| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 1 RP:SCP:REP 263->310|1a04A1|2e-09|39.6|48/67|a.4.6.2| HM:SCP:REP 29->170|1mc0A2|6.8e-07|26.4|140/0|d.110.2.1|1/1|GAF domain-like| HM:SCP:REP 229->315|1p4wA_|4.4e-18|39.1|87/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 22.9 SQ:SECSTR ################################################################################################################################################################################################################################################cccHHHHTTcccHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccHHHHHHHHHHTccTc## DISOP:02AL 1-8, 232-250| PSIPRED cccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccEEcccccccccEEEEEccccccHHHHHHHHcccHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHcHHHcc //