[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57681.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  56/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.1a.4.5
:101 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->95 3f6vA PDBj 1e-08 38.8 %
:RPS:PDB   16->92 1bibA PDBj 7e-10 19.7 %
:RPS:SCOP  12->91 2jn6A1  a.4.1.19 * 5e-09 13.5 %
:HMM:SCOP  2->92 1u2wA1 a.4.5.5 * 6.9e-17 36.5 %
:HMM:PFM   18->68 PF01022 * HTH_5 1.7e-07 38.6 44/47  
:BLT:SWISS 10->92 YUZN_BACSU 1e-19 49.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57681.1 GT:GENE BAD57681.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3021734..3022039 GB:FROM 3021734 GB:TO 3022039 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57681.1 LENGTH 101 SQ:AASEQ MAVVDADPDLFKAIGDATRRTILDELIDRDGQTLFELCGRLTMKHGLTSSRQAISQHLAVLEQAGLVRTRRQGRYKFHHIDTRPLRAIVERWPIDREEPKP GT:EXON 1|1-101:0| BL:SWS:NREP 1 BL:SWS:REP 10->92|YUZN_BACSU|1e-19|49.4|83/92| BL:PDB:NREP 1 BL:PDB:REP 9->95|3f6vA|1e-08|38.8|80/96| RP:PDB:NREP 1 RP:PDB:REP 16->92|1bibA|7e-10|19.7|71/294| HM:PFM:NREP 1 HM:PFM:REP 18->68|PF01022|1.7e-07|38.6|44/47|HTH_5| RP:SCP:NREP 1 RP:SCP:REP 12->91|2jn6A1|5e-09|13.5|74/89|a.4.1.19| HM:SCP:REP 2->92|1u2wA1|6.9e-17|36.5|85/0|a.4.5.5|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 71 OP:NHOMOORG 57 OP:PATTERN -------------------------------------------------------------------- --1-1---------1------2--12-----122222111------------21---1---1--1-2--1--------------------------------------------------------------------------1---------------------------------------------------------------------1------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------221--11-1----------------1------11---1---1---1111-1--1-------1-----------------------------------------------------------1-----------------2----------2--------------------------------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------11----------------111111------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 92.1 SQ:SECSTR ########HccHccHcHHHHHHHHHHTTcccccHHHHHHHHTcHHcccccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccHHHHHHTcccccHHH DISOP:02AL 100-101| PSIPRED ccccccHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccEEEEccccEEEEEEcHHHHHHHHHHHHHHHHcccc //