[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57682.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  61/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   3->126 3e5dA PDBj 6e-13 11.6 %
:RPS:SCOP  2->129 1sqiA1  d.32.1.3 * 5e-16 20.6 %
:HMM:SCOP  2->128 1t47A2 d.32.1.3 * 2.5e-23 37.0 %
:RPS:PFM   3->103 PF00903 * Glyoxalase 2e-07 45.6 %
:HMM:PFM   4->125 PF00903 * Glyoxalase 4.2e-17 32.8 119/128  
:BLT:SWISS 2->125 YURT_BACSU 3e-38 56.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57682.1 GT:GENE BAD57682.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3022036..3022425 GB:FROM 3022036 GB:TO 3022425 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57682.1 LENGTH 129 SQ:AASEQ MIRINITSVYVDDQAKALDFYTGKLGFVKKTDEPAGGARWLTVVSPADPDGVELLLEPDGHPAARTYKDALVADGIPFTQFAVDDVYAEVDRLKGLGVEFTQEATDLGPVVTAVFDDTCGNLIQLAAMK GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 2->125|YURT_BACSU|3e-38|56.5|124/127| RP:PDB:NREP 1 RP:PDB:REP 3->126|3e5dA|6e-13|11.6|121/122| RP:PFM:NREP 1 RP:PFM:REP 3->103|PF00903|2e-07|45.6|90/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 4->125|PF00903|4.2e-17|32.8|119/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 2->129|1sqiA1|5e-16|20.6|126/149|d.32.1.3| HM:SCP:REP 2->128|1t47A2|2.5e-23|37.0|127/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 73 OP:NHOMOORG 64 OP:PATTERN -----------------------1--------------------1-1--------------------- -11-2---111----------2--11-----121111------1--------211--1---1--1-2122----------------------------------11-1------------------------------------1---------------------------------------------------------------------1------1--------------------------1--11------------------------------------------------------------------------------111------------------------------1------------------------------------------------------1---------------------------------------------------------------------------------111--------------1-------2-1------11------1---1----------------------------------------------------1-------------------------------------------------------1--1-------------------------------------------------------------------------------------------------------------------------------------------------1----1111-------------------------1--11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 100.0 SQ:SECSTR GccccEEEEEcccHHHHHHHHHTHHccEEcccEEEGGGTEEEEEEEcccccEEEEEETTcccccccccccccEEcEEEEcccHHHHHHHHHHHHHTTccEEEEEEcTTccEEEEEEcTTccEEEEEccc DISOP:02AL 65-70| PSIPRED cEEEEEEEEEEccHHHHHHHHHHHcccEEEEEccccccEEEEEEEccccccEEEEEEccccccccccccccccccEEEEEEEEccHHHHHHHHHHcccEEEEccEEccccEEEEEEcccccEEEEEEEc //