[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57684.1
DDBJ      :             putative two-component system response regulator
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  710/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:206 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->202 1yioA PDBj 4e-39 41.8 %
:RPS:PDB   9->197 3c3wB PDBj 3e-25 25.4 %
:RPS:SCOP  9->122 1p2fA2  c.23.1.1 * 9e-21 29.1 %
:RPS:SCOP  145->197 1h0mA1  a.4.6.2 * 2e-12 24.5 %
:HMM:SCOP  4->179 1s8nA_ c.23.1.1 * 6.5e-29 28.0 %
:RPS:PFM   11->119 PF00072 * Response_reg 4e-14 33.9 %
:RPS:PFM   145->197 PF00196 * GerE 1e-09 54.7 %
:HMM:PFM   9->118 PF00072 * Response_reg 5.7e-29 31.8 110/112  
:HMM:PFM   143->191 PF00196 * GerE 6.9e-17 49.0 49/58  
:BLT:SWISS 4->205 FIXJ_AZOC5 3e-36 38.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57684.1 GT:GENE BAD57684.1 GT:PRODUCT putative two-component system response regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3023022..3023642) GB:FROM 3023022 GB:TO 3023642 GB:DIRECTION - GB:PRODUCT putative two-component system response regulator GB:PROTEIN_ID BAD57684.1 LENGTH 206 SQ:AASEQ MNAESAPVVHVVDDDEDLRQSLAFLLQSVGIEALTYATATSFLEEVDFDEAGVVIVDVRMPGLSGFQLQEQLNQRDYPAPIIFCSAHGDIPMSVRALRAGAVDFLEKPYEPQRMLEVVQEQLPVATRLFAERADRLRVRARLDGLTPRERDVLRLVIEGRSSQQIASRLGTSVKTVDVHRARIKAKTESESLGTLVRDILAYRVAV GT:EXON 1|1-206:0| BL:SWS:NREP 1 BL:SWS:REP 4->205|FIXJ_AZOC5|3e-36|38.8|201/211| SEG 132->143|radrlrvrarld| BL:PDB:NREP 1 BL:PDB:REP 7->202|1yioA|4e-39|41.8|196/198| RP:PDB:NREP 1 RP:PDB:REP 9->197|3c3wB|3e-25|25.4|189/210| RP:PFM:NREP 2 RP:PFM:REP 11->119|PF00072|4e-14|33.9|109/111|Response_reg| RP:PFM:REP 145->197|PF00196|1e-09|54.7|53/57|GerE| HM:PFM:NREP 2 HM:PFM:REP 9->118|PF00072|5.7e-29|31.8|110/112|Response_reg| HM:PFM:REP 143->191|PF00196|6.9e-17|49.0|49/58|GerE| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 2 RP:SCP:REP 9->122|1p2fA2|9e-21|29.1|110/120|c.23.1.1| RP:SCP:REP 145->197|1h0mA1|2e-12|24.5|53/65|a.4.6.2| HM:SCP:REP 4->179|1s8nA_|6.5e-29|28.0|175/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 3667 OP:NHOMOORG 717 OP:PATTERN -----------------------------1-----------------1---1---------------- 8LH-5211111-1221111-13--1311111133336766313453132111223-21--2251412554111111111-23-121212332-1-----2-2-1242531------------------11-1212-6BBA932182636B5556612111213556498D212111111111122211--14223333344313335534533343364448124111111C9-222222222222222222------------11--11---------111----------------------------------------1283334443433222234411--135--5234-A75621313322122--C6A54433333378OCB557BA69966566666667-79879A9F39B-7993B78AG7HDEA25354687885672222222242212845--111111--1111---11111111----13753134226EAAFBAA7776CCHJ8888488EC878B138A4AA933C68EB46997A888A-------133BEJ2GNB68GB3BDAAE2GIKDGFF9DJKIMEE7G3112122222----------1111233A8548383855A999947BABA7CAB97A7--26947------82232745667566755-6555567555665555445656235479689999999889899455533442-844444344444--14-----222162B48---1--------112333333211274DDDD9CGCABBCC9ECB---------23667AAAAA7B7BC777454433322222-311133331111111111--------------------------11122232122I1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------2--------------5-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 203 STR:RPRED 98.5 SQ:SECSTR cccccccEEEEEcccHHHHHHHHHHHHTcTTEEEEEccHHHHHHHHHHHcccEEEEccEETTEEHHHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTccHHHHHHHHHHTTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccccHHHHHHHHHH### DISOP:02AL 1-4, 131-143| PSIPRED cccccccEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccc //