[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57685.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   45->157 3b8lB PDBj 7e-06 34.7 %
:RPS:PDB   17->160 3b8lB PDBj 7e-21 27.0 %
:RPS:SCOP  17->168 3b8lA1  d.17.4.28 * 8e-31 29.8 %
:HMM:SCOP  13->174 3stdA_ d.17.4.1 * 8.2e-22 31.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57685.1 GT:GENE BAD57685.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3023678..3024235) GB:FROM 3023678 GB:TO 3024235 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57685.1 LENGTH 185 SQ:AASEQ MTEADTIARLVRRIETLEGEAEVRRLQARYMFLCDTPCPEFGVADDARRIDLIMDLYSEDAVWEGVGEYYDNQFGRLVGHAAIRAHFERFWSPDREPRLVLNAHYPTAEQIHVDGDTAQGQWIHMQPWLFADGTALLRSSRLNNAFRRIDGVWKITRTRTENVFVAPLPANFAEHFPTRSVLMTP GT:EXON 1|1-185:0| BL:PDB:NREP 1 BL:PDB:REP 45->157|3b8lB|7e-06|34.7|101/137| RP:PDB:NREP 1 RP:PDB:REP 17->160|3b8lB|7e-21|27.0|122/137| RP:SCP:NREP 1 RP:SCP:REP 17->168|3b8lA1|8e-31|29.8|131/144|d.17.4.28| HM:SCP:REP 13->174|3stdA_|8.2e-22|31.3|147/0|d.17.4.1|1/1|NTF2-like| OP:NHOMO 36 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- ----------1-------------------------1-11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------11111111---------------------------------------12-------1-11111----111------11-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------1---------------11111-----------------1------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 178 STR:RPRED 96.2 SQ:SECSTR TccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHTTcHHHTHHHTTccHHHHHTTEEEEEEEEcGGGTcccEEHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEETTccEEEEEEEEEEEEEEETTEEEEEEEEEEEccccccTTHccHHHHH####### DISOP:02AL 1-3| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccHHcccccccccHHHHHHHHHHccccccccccEEccccccccEEEEEcccEEEEEEEEEcccccccEEEEEEEHHEEEEccccccEEEEEEEEEEEEEEcccccHHHHccccEEEEcc //