[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57687.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57687.1 GT:GENE BAD57687.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3025464..3025703) GB:FROM 3025464 GB:TO 3025703 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57687.1 LENGTH 79 SQ:AASEQ MCYNDTHGYGWRHVDLFLHDASGRELNWVHWQADADGPEAADRVTAAAEPSLRRTSEWRHGVSASGMDYWSADAAWSDR GT:EXON 1|1-79:0| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ----------1-------------------------1-11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 78-79| PSIPRED ccccccccccEEEEEEEEEcccccEEEEEEEEEEcccccHHHHHHHHccccccccccccccccccccEEEEEccccccc //