[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57691.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:121 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57691.1 GT:GENE BAD57691.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3029191..3029556 GB:FROM 3029191 GB:TO 3029556 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57691.1 LENGTH 121 SQ:AASEQ MTDSPLRVLFCIGINQNFFDLPEGGVTPADVWTGFVALSDGIKALDGIDFLGDMDDDSTMVGPSDGWPWTCYLLADADSHDTVKAACNLVRTIPVGSSDWKLWKFLKIEARIGRALTPRQY GT:EXON 1|1-121:0| SEG 45->57|ldgidflgdmddd| OP:NHOMO 34 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- ----------1-------------------------1-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111---------------------------------------11-------1-11111----111------11-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------1---------------11111-----------------1------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 120-121| PSIPRED cccccEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHcccEEEEEEEccccEEEEccccccEEEEEEEccccccHHHHHHHHHHEEccccccccEEEEEEEEEEcccccccccc //