[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57693.1
DDBJ      :             putative ring-cleavage dioxygenase small subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  39/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:170 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->156 2b24B PDBj 2e-07 31.6 %
:RPS:PDB   18->159 3e99A PDBj 2e-14 22.0 %
:RPS:SCOP  18->159 1eg9B  d.17.4.4 * 6e-14 16.3 %
:HMM:SCOP  8->170 1eg9B_ d.17.4.4 * 9.2e-29 28.4 %
:RPS:PFM   26->159 PF00866 * Ring_hydroxyl_B 3e-04 34.8 %
:HMM:PFM   25->158 PF00866 * Ring_hydroxyl_B 3e-24 31.8 132/145  
:BLT:SWISS 21->158 BPHA2_PSES1 2e-07 31.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57693.1 GT:GENE BAD57693.1 GT:PRODUCT putative ring-cleavage dioxygenase small subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3030875..3031387 GB:FROM 3030875 GB:TO 3031387 GB:DIRECTION + GB:PRODUCT putative ring-cleavage dioxygenase small subunit GB:PROTEIN_ID BAD57693.1 LENGTH 170 SQ:AASEQ MTDTLTAPATLTDARVLRAIELIWREADLLDRKDYHAWQELYTDDAHYVVPIDRTTDDFDNTLNMIYDDARMRGMRVVRMTEGYAIAAVDAATTTRTVSRFVPESVTDTEVVLRAAQILIAYKRGRHDIWAGDVEYRIRLGADAAADRIARKVVRLVDSEDAVPAAGFLL GT:EXON 1|1-170:0| BL:SWS:NREP 1 BL:SWS:REP 21->158|BPHA2_PSES1|2e-07|31.1|135/193| SEG 2->14|tdtltapatltda| SEG 85->97|aiaavdaatttrt| BL:PDB:NREP 1 BL:PDB:REP 21->156|2b24B|2e-07|31.6|133/165| RP:PDB:NREP 1 RP:PDB:REP 18->159|3e99A|2e-14|22.0|132/146| RP:PFM:NREP 1 RP:PFM:REP 26->159|PF00866|3e-04|34.8|132/145|Ring_hydroxyl_B| HM:PFM:NREP 1 HM:PFM:REP 25->158|PF00866|3e-24|31.8|132/145|Ring_hydroxyl_B| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF00866|IPR000391| GO:PFM GO:0006725|"GO:cellular aromatic compound metabolic process"|PF00866|IPR000391| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00866|IPR000391| RP:SCP:NREP 1 RP:SCP:REP 18->159|1eg9B|6e-14|16.3|141/193|d.17.4.4| HM:SCP:REP 8->170|1eg9B_|9.2e-29|28.4|162/0|d.17.4.4|1/1|NTF2-like| OP:NHOMO 40 OP:NHOMOORG 39 OP:PATTERN -------------------------------------------------------------------- ----------1----1--------------------1-11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------11111111---------------------------------------12---111-1-11111----111------11-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------1---------------11111-----------------1------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 153 STR:RPRED 90.0 SQ:SECSTR #################HHHHHHHHHHHHHHTTcHHHHHTTEEEEEEEEEcccccEccccccEEEEEccHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEEEETTEEEEEEEEEEEEEETTEEEEEEEEEEEEEEccccccEcEEEEEEEEEcccccccccccccc DISOP:02AL 1-3| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccEEEEEEEccccccccccEEEEEccccHHHHHHHHHHcccEEEccccccEEEEEEcEEEEEccccEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEcccccccccccc //