[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57695.1
DDBJ      :             putative ferredoxin reductase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  380/915 : Eukaryota  33/199 : Viruses  0/175   --->[See Alignment]
b.43.4c.25.1d.15.4
:318 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->317 2piaA PDBj 6e-55 40.3 %
:RPS:PDB   4->226 1cqxA PDBj 4e-31 23.4 %
:RPS:PDB   212->317 1doiA PDBj 1e-14 23.6 %
:RPS:SCOP  3->97 2piaA1  b.43.4.2 * 1e-16 37.9 %
:RPS:SCOP  102->252 1ep1B2  c.25.1.3 * 1e-20 17.6 %
:RPS:SCOP  233->314 1a70A  d.15.4.1 * 3e-13 24.4 %
:HMM:SCOP  1->97 2piaA1 b.43.4.2 * 1.6e-26 37.1 %
:HMM:SCOP  95->238 1ep3B2 c.25.1.3 * 2.1e-27 37.0 %
:HMM:SCOP  210->317 1e0zA_ d.15.4.1 * 1.3e-22 38.3 %
:RPS:PFM   8->95 PF00970 * FAD_binding_6 3e-06 33.3 %
:RPS:PFM   110->203 PF00175 * NAD_binding_1 7e-05 34.4 %
:HMM:PFM   239->308 PF00111 * Fer2 2e-12 30.9 68/77  
:HMM:PFM   6->95 PF00970 * FAD_binding_6 4.1e-09 26.4 87/99  
:HMM:PFM   110->203 PF00175 * NAD_binding_1 1.3e-07 29.0 93/109  
:BLT:SWISS 4->317 VANB_PSEUH 3e-59 40.9 %
:PROS 266->274|PS00197|2FE2S_FER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57695.1 GT:GENE BAD57695.1 GT:PRODUCT putative ferredoxin reductase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3032132..3033088 GB:FROM 3032132 GB:TO 3033088 GB:DIRECTION + GB:PRODUCT putative ferredoxin reductase GB:PROTEIN_ID BAD57695.1 LENGTH 318 SQ:AASEQ MPTMKVTVAQIVSETPSIRSLRLVREDGRPLGPYRAGAHIDVTGPTGILRQYSLCGPPSEAQSLTIAVKREPDSRGGSAALHEVCEGDIIEIGEPRNILAVDPDATRHVLVAAGIGVTPLLSMAYELHGNGAEFELRYFTRSRTETAFADLLENRAEFRDRVRLHTGLSRADQRSTLDDLAATLTPGTAVYTCGPAGFMDTVAEVVTPVVGAPNLHIEHFEAAAVDTSGDTAFTVELDTGESFEIPADRSILSVLEENGIEVFKSCEEGICGSCVSGVLEGEPEHRDNCLSVADKAAGDQIALCVSRARTPKLVIELF GT:EXON 1|1-318:0| BL:SWS:NREP 1 BL:SWS:REP 4->317|VANB_PSEUH|3e-59|40.9|313/317| PROS 266->274|PS00197|2FE2S_FER_1|PDOC00175| BL:PDB:NREP 1 BL:PDB:REP 4->317|2piaA|6e-55|40.3|310/321| RP:PDB:NREP 2 RP:PDB:REP 4->226|1cqxA|4e-31|23.4|222/403| RP:PDB:REP 212->317|1doiA|1e-14|23.6|106/128| RP:PFM:NREP 2 RP:PFM:REP 8->95|PF00970|3e-06|33.3|87/99|FAD_binding_6| RP:PFM:REP 110->203|PF00175|7e-05|34.4|93/107|NAD_binding_1| HM:PFM:NREP 3 HM:PFM:REP 239->308|PF00111|2e-12|30.9|68/77|Fer2| HM:PFM:REP 6->95|PF00970|4.1e-09|26.4|87/99|FAD_binding_6| HM:PFM:REP 110->203|PF00175|1.3e-07|29.0|93/109|NAD_binding_1| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00970|IPR008333| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00970|IPR008333| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00175|IPR001433| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00175|IPR001433| RP:SCP:NREP 3 RP:SCP:REP 3->97|2piaA1|1e-16|37.9|95/103|b.43.4.2| RP:SCP:REP 102->252|1ep1B2|1e-20|17.6|148/160|c.25.1.3| RP:SCP:REP 233->314|1a70A|3e-13|24.4|82/97|d.15.4.1| HM:SCP:REP 1->97|2piaA1|1.6e-26|37.1|97/0|b.43.4.2|1/1|Riboflavin synthase domain-like| HM:SCP:REP 95->238|1ep3B2|2.1e-27|37.0|135/0|c.25.1.3|1/1|Ferredoxin reductase-like, C-terminal NADP-linked domain| HM:SCP:REP 210->317|1e0zA_|1.3e-22|38.3|107/128|d.15.4.1|1/1|2Fe-2S ferredoxin-like| OP:NHOMO 1064 OP:NHOMOORG 413 OP:PATTERN -------------------------------------------------------------------- -11-3-12112---96545-48--5B444445898996LI11-41--2----22111---533-254442------------------------------11111112-1-------------------------------------1---------------------1-----------------------1------111-------1-----1---11-11------1-1111111-11111111--11--------------------------------------------------------------------------------------------------------------------------2211-------1634---211211111111-111--1311214-1--21112123334533----221--12261111111121112----------------------------------131126334534846433347757333323B595856-142343-1-63528A-6111-22-----------251----------------------------1------------------------------22111-1-111-1-11--211111121111-------------22132224332422244-344432243432333433466622-12222222222222222233333333--233333333333----------111-1153111--1---------5656633---1-332342-2365362222----------1223-11-11112211333331111111----22----------------------------------------------------- ----12---------2-1----1111---------------------1114223111-1121-1---1-------------11--1------------------------------------------------------------------------------------------------------11----1112- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 317 STR:RPRED 99.7 SQ:SECSTR #EEEEEEEEEEEEccccEEEEEEEETTccccccccTTcEEEEETTEEEEEEEEccccccccEEEEccccTTccccHHHHHHHHccTTcEEEEccccccccccTTccccEEEEccccHHHHHHHHHHHTcccccEEEEEEEccccccHHHHHHHHHHHHcTTEEEEEEEccccTTcccTcHHHHccTTcEEEEEccHHHHHHHHHHHHHHTTccGEEEccccccTTcHHHHccEEEEcTTEEEEEccTTccHHHHHHHTTcccccccccccccTTEEEEEEccEEEccccccHHHHHTccEEEGGGEEEcccEEEEEEc PSIPRED cccEEEEEEEEEEccccEEEEEEEEcccccccccccccEEEEEccccEEEEEEEccccccccEEEEEEEEEccccHHHHHHHHcccccEEEEEccccccccccccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEEEccHHHHccHHHHHHHHHHcccEEEEEEEccccccccHHHHHHHcccccEEEEEccHHHHHHHHHHHHHcccHHHEEEEHHccccccccccccEEEEEcccEEEEEcccccHHHHHHHccccccccccccccccEEEEEEEEEEEccccccccHHHHHccEEEEEEEEEcccEEEEEcc //