[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57696.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:97 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->89 PF04341 * DUF485 2.1e-18 28.6 77/91  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57696.1 GT:GENE BAD57696.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3033112..3033405 GB:FROM 3033112 GB:TO 3033405 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57696.1 LENGTH 97 SQ:AASEQ MQDTPALAPPSDDDLDAAARERAALILRLSAIVLVLFFPLPVLGGFTSLLDTVVFSGVTLAWIYAAAQFVVAVVVARYYMSRAAALESRTAGEGTRA GT:EXON 1|1-97:0| TM:NTM 2 TM:REGION 22->44| TM:REGION 55->77| SEG 3->46|dtpalappsdddldaaareraalilrlsaivlvlffplpvlggf| SEG 64->85|yaaaqfvvavvvaryymsraaa| HM:PFM:NREP 1 HM:PFM:REP 13->89|PF04341|2.1e-18|28.6|77/91|DUF485| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 7-8, 88-97| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //