[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57698.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:237 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   62->236 PF09203 * MspA 5e-09 36.9 %
:HMM:PFM   38->237 PF09203 * MspA 3.6e-54 44.8 172/175  
:REPEAT 2|69->121|122->170
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57698.1 GT:GENE BAD57698.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3035011..3035724) GB:FROM 3035011 GB:TO 3035724 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57698.1 LENGTH 237 SQ:AASEQ MMKRTHVSIMAAIGAVTVTAIGSAAPAAGTAPGEVAAGAARMVAAVDFAQVVPAGDTAFGVPFVHAVKVSGDFSVALDGVSALRGGEVAAGYLVGCAVDVSDGISVAIAPEVGMSASISPSIGADFGVDLGLSVDAPPEVGIGFGVGVGLEPSIGVEGAVAGELSLSLAPGTVTAVPIGVAELDEESTFPFTFAHANTPLHVNGCLSPASAMPFITVRADTPGSTLQTTGYGDPFTF GT:EXON 1|1-237:0| NREPEAT 1 REPEAT 2|69->121|122->170| SEG 20->49|aigsaapaagtapgevaagaarmvaavdfa| RP:PFM:NREP 1 RP:PFM:REP 62->236|PF09203|5e-09|36.9|149/175|MspA| HM:PFM:NREP 1 HM:PFM:REP 38->237|PF09203|3.6e-54|44.8|172/175|MspA| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEEEccEEEEcccccccccEEEEEEEccEEEEEEEccccccccEEEccEEEEEEEEccccccEEccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccEEEEccccEEEEccccccccccccccEEccccccEEEEEEcccccEEccEEEEEEEccccEEccEEccccccc //