Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57699.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:111 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57699.1 GT:GENE BAD57699.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3036036..3036371 GB:FROM 3036036 GB:TO 3036371 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57699.1 LENGTH 111 SQ:AASEQ MPLLRPLLALAAPVGVMLLGTGTASALSVSPAADAVVIEFAHAEAQVITNLNLGPVLGTLPPSFSPLGRQRLGEAIGRGAATAAQTPGSRVIIRVDQPVAASPGISVEVVR GT:EXON 1|1-111:0| TM:NTM 2 TM:REGION 11->33| TM:REGION 46->68| SEG 1->20|mpllrpllalaapvgvmllg| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 53-53,101-101,104-104| PSIPRED ccHHHHHHHHHccccEEEEEcccccEEEEcccccEEEEEEEcccEEEEEEcccccHHHcccccccHHHHHHHHHHHccccHHHccccccEEEEEEccccccccccEEEEEc //