[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57705.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  116/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.116.1
:158 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->158 2z0kA PDBj 9e-21 36.6 %
:RPS:PDB   5->157 2cx5A PDBj 1e-20 37.5 %
:RPS:SCOP  11->157 1wdvA  d.116.1.1 * 2e-22 26.0 %
:HMM:SCOP  10->157 1dbxA_ d.116.1.1 * 1.5e-34 31.8 %
:RPS:PFM   42->133 PF04073 * YbaK 4e-10 40.2 %
:HMM:PFM   30->148 PF04073 * YbaK 8.1e-31 32.8 119/123  
:BLT:SWISS 42->119 SYP_DESVH 6e-09 35.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57705.1 GT:GENE BAD57705.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3042880..3043356) GB:FROM 3042880 GB:TO 3043356 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57705.1 LENGTH 158 SQ:AASEQ MPEHLPPNALRVAAALRAHGVAGEIVVLPEPAPTAAAAAAQLGCPVGAIANSLIFDADGAPVLVLTSGAHRVDVELVARHAGVATLRRAAPEVVRAATGQPIGGVAPLGHPAPVRTFVDKWLAEHEVVWAAAGHPHTVFPTSFDELVRVTGGTPIDVE GT:EXON 1|1-158:0| BL:SWS:NREP 1 BL:SWS:REP 42->119|SYP_DESVH|6e-09|35.9|78/574| SEG 29->40|pepaptaaaaaa| BL:PDB:NREP 1 BL:PDB:REP 5->158|2z0kA|9e-21|36.6|153/156| RP:PDB:NREP 1 RP:PDB:REP 5->157|2cx5A|1e-20|37.5|152/157| RP:PFM:NREP 1 RP:PFM:REP 42->133|PF04073|4e-10|40.2|92/122|YbaK| HM:PFM:NREP 1 HM:PFM:REP 30->148|PF04073|8.1e-31|32.8|119/123|YbaK| RP:SCP:NREP 1 RP:SCP:REP 11->157|1wdvA|2e-22|26.0|146/150|d.116.1.1| HM:SCP:REP 10->157|1dbxA_|1.5e-34|31.8|148/157|d.116.1.1|1/1|YbaK/ProRS associated domain| OP:NHOMO 122 OP:NHOMOORG 118 OP:PATTERN ------------------------------11------------------------------------ ----1---------1----------1----------112111--21------111--1--111-1-11111-----------1--------------------------------------------------------------1----------------------------------------11-------------------------------------------1---------------------------------------------------------------------------------------------1--1111-11-------------------1----111-11-1-1-----------------------------------------------------111---------1----1111-11--1111111111-----11-----------------------------1--1---11-11121211----11111111111111111--11111111111111--1---------------------------1----1-1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------1--------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 154 STR:RPRED 97.5 SQ:SECSTR ####ccHHHHHHHHHHHHTTcTTccEEccTTcccHHHHHHHHTccGGGEEEEEEEEccccEEEEEEETTccccHHHHHHHHTHcccEEccHHHHHHHHcccTTccccccccccccEEEEGGGGGcccEEEEcccTTEEEEEcHHHHHHHHccEEEccc DISOP:02AL 1-8| PSIPRED ccccccHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHcccHHHEEEEEEEEEcccEEEEEEcccccccHHHHHHHHcccccccccHHHHHHHHccccccccccccccccEEEEcHHHHccccEEEEccccccEEEEcHHHHHHHHccEEEEEc //