[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57706.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:83 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->69 PF06055 * ExoD 0.00081 22.0 59/187  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57706.1 GT:GENE BAD57706.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3043430..3043681 GB:FROM 3043430 GB:TO 3043681 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57706.1 LENGTH 83 SQ:AASEQ MRPNSATARVRCTLAAAVVGAALVVSTAPTASALPAGPLAVAPVATPAESGSSSGSGYLLEAALNALCVLTGSQPGCWGSVPR GT:EXON 1|1-83:0| SEG 14->25|laaavvgaalvv| SEG 31->48|asalpagplavapvatpa| SEG 50->57|sgsssgsg| HM:PFM:NREP 1 HM:PFM:REP 11->69|PF06055|0.00081|22.0|59/187|ExoD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 47-56| PSIPRED cccccccEEEEHHHHHHHHHHHHHHcccccccccccccEEEccccccccccccccccEEHHHHHcEEEEEEcccccccccccc //