[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57708.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:257 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->63 1q06B PDBj 1e-07 36.2 %
:RPS:PDB   4->97 3d70A PDBj 7e-13 19.6 %
:RPS:SCOP  3->66 1j9iA  a.6.1.5 * 2e-12 18.8 %
:RPS:SCOP  45->78 1q08A  a.6.1.3 * 9e-06 23.5 %
:HMM:SCOP  4->112 1q06A_ a.6.1.3 * 5.2e-16 27.5 %
:HMM:PFM   5->42 PF00376 * MerR 1.9e-10 36.8 38/38  
:BLT:SWISS 5->79 YFMP_BACSU 6e-08 36.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57708.1 GT:GENE BAD57708.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3044488..3045261) GB:FROM 3044488 GB:TO 3045261 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57708.1 LENGTH 257 SQ:AASEQ MTEYRIDDLARAAGTTSRNVRLYQERGLLPQPVRREGRANIYDDSHLARLQIVNGLLERGFTLAHITDFITSWETGKDLTEILGLQKAVTDAWGARHDPVQLPRDAVVALLADLDAEQAEEKHLDRLADLQLVRTDDDTVTLLRPDLVEVLLELHGDGIDLATMIDLYADLRAKLEDVARTLVVAAKNRIVDDHGPGWLPDTDAETAATTQMLTRWRELGTRIVHSGLEQALDAVLQRELGDYLGAAARQRHSRSDT GT:EXON 1|1-257:0| BL:SWS:NREP 1 BL:SWS:REP 5->79|YFMP_BACSU|6e-08|36.1|72/140| SEG 105->121|davvalladldaeqaee| BL:PDB:NREP 1 BL:PDB:REP 6->63|1q06B|1e-07|36.2|58/126| RP:PDB:NREP 1 RP:PDB:REP 4->97|3d70A|7e-13|19.6|92/276| HM:PFM:NREP 1 HM:PFM:REP 5->42|PF00376|1.9e-10|36.8|38/38|MerR| RP:SCP:NREP 2 RP:SCP:REP 3->66|1j9iA|2e-12|18.8|64/68|a.6.1.5| RP:SCP:REP 45->78|1q08A|9e-06|23.5|34/94|a.6.1.3| HM:SCP:REP 4->112|1q06A_|5.2e-16|27.5|109/127|a.6.1.3|1/1|Putative DNA-binding domain| OP:NHOMO 60 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- ----1---------111----2--11-----121111-11------------------------1-12131--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111-1111-11111-11--111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------1111----1--------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 36.6 SQ:SECSTR ###EEHHHHHHHHTccHHHHHHHHHTTccccEEcTTTccEEEcGGGGGHHHHHHHHHHHTccHHHHHHHTTccHcHHHHHHHHHHHHHHHHHHHHHH################################################################################################################################################################ DISOP:02AL 249-250, 252-257| PSIPRED cccccHHHHHHHHcccHHHHHHHHHHcccccccccccccEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //