[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57710.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.1
:305 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   4->171 3dhiA PDBj 1e-13 16.8 %
:RPS:SCOP  8->189 1fyzA  a.25.1.2 * 2e-20 20.3 %
:HMM:SCOP  10->246 1mtyD_ a.25.1.2 * 7.4e-43 29.5 %
:HMM:PFM   39->173 PF11583 * AurF 8.7e-06 21.2 132/304  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57710.1 GT:GENE BAD57710.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3046869..3047786) GB:FROM 3046869 GB:TO 3047786 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57710.1 LENGTH 305 SQ:AASEQ MAFDFDAMLAKIKARQWALADIDWDAPGAETIDPDLHARLAPFMADLMWIENVGARGFAAMAKKAPTDTLKEIYRYFHAEEQRHANAELALMRRWGMLDGDEIPEPNINVKLVIDFLDKHSDGLSLSILGTVIPMLEVALDGALIKFVTDEIADPVAQEVFKRINADESRHLATDYAVMELLGHATARKLAIDFVGSWANPALIVGALSYFPLLNKMRDNIVEMGVSEDRLYAAMARFKAVGQRAPIVNRLPMYQVVKLHSDWVIDRSHPYHLLADGLVKVTGRIPGRFFSRPTWSKSLTYEPVA GT:EXON 1|1-305:0| RP:PDB:NREP 1 RP:PDB:REP 4->171|3dhiA|1e-13|16.8|167/498| HM:PFM:NREP 1 HM:PFM:REP 39->173|PF11583|8.7e-06|21.2|132/304|AurF| RP:SCP:NREP 1 RP:SCP:REP 8->189|1fyzA|2e-20|20.3|182/511|a.25.1.2| HM:SCP:REP 10->246|1mtyD_|7.4e-43|29.5|234/0|a.25.1.2|1/1|Ferritin-like| OP:NHOMO 16 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- --------------411----2--2-------11111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 253 STR:RPRED 83.0 SQ:SECSTR cTTHHHHHHHHHHHHHHHHHHHTTTccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTHTcGGGGHHHcccHHHHHHHHHHHHHTTcccHHHHHHHcccccTTTTHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccTTHHHHHHHHHHHHHHHHHHHHHcccTHHHHHHHHHHTcTTHHHHHHHcccccccHHHHHHHTTcT#################################################### DISOP:02AL 304-305| PSIPRED ccccHHHHHHHHHHcccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccHHccccccc //