[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57714.1
DDBJ      :             putative transporter
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  482/915 : Eukaryota  12/199 : Viruses  1/175   --->[See Alignment]
f.38.1
:459 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  20->407 1pw4A  f.38.1.1 * 3e-08 13.1 %
:HMM:SCOP  2->443 1pw4A_ f.38.1.1 * 2.9e-65 26.3 %
:RPS:PFM   41->442 PF00083 * Sugar_tr 4e-17 30.2 %
:HMM:PFM   24->443 PF00083 * Sugar_tr 1.3e-36 20.2 405/451  
:BLT:SWISS 20->437 SHIA_ECOLI 4e-72 40.0 %
:PROS 307->324|PS00216|SUGAR_TRANSPORT_1
:PROS 134->159|PS00217|SUGAR_TRANSPORT_2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57714.1 GT:GENE BAD57714.1 GT:PRODUCT putative transporter GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3051463..3052842) GB:FROM 3051463 GB:TO 3052842 GB:DIRECTION - GB:PRODUCT putative transporter GB:PROTEIN_ID BAD57714.1 LENGTH 459 SQ:AASEQ MMSVGTAGPGTEPAAPTGLRRVVAASMAGTVVEWYEFFLYGTAATLVFNKVFFAQGTSDLDAILAAFVTYAVGFAARPLGGVVFGHFGDKYGRKKLLQLSLLLVGAATFLMGCLPTFGQVGYLAPTLLVTLRFIQGFAVGGEWGGAVLLVAEHSPDRSRAFWASWPQAAVPVGNMLATVVLLFLTSTLSDAAFLSWGWRVAFWLSAVVVFIGYYVRTKITDAPIFLAAQQQAEQEKATGFSAVEVFKRYPRGVLTAMGLRFGENIMYYLVVTFSITYLKVHVGADTTVILWWLLAAHAVHFAIIPLVGRLSDRYGRRPVYLVGAVTAGTWGFFAFPMMDSGHNAVILSAVILGLVFHAFMYSAQPAIMAEMFPTRMRYSGVSLGYQVTSIVAGSLAPIIAVRLLDTYQSAVPIAIYLALACAITAVAVLFARETKGANLAELDSADARELAGTAKAVRA GT:EXON 1|1-459:0| BL:SWS:NREP 1 BL:SWS:REP 20->437|SHIA_ECOLI|4e-72|40.0|415/438| PROS 307->324|PS00216|SUGAR_TRANSPORT_1|PDOC00190| PROS 134->159|PS00217|SUGAR_TRANSPORT_2|PDOC00190| TM:NTM 10 TM:REGION 33->55| TM:REGION 62->84| TM:REGION 96->118| TM:REGION 120->141| TM:REGION 171->193| TM:REGION 195->216| TM:REGION 286->308| TM:REGION 329->351| TM:REGION 384->406| TM:REGION 410->432| SEG 96->103|llqlslll| SEG 176->189|latvvllfltstls| SEG 227->237|aaqqqaeqeka| RP:PFM:NREP 1 RP:PFM:REP 41->442|PF00083|4e-17|30.2|374/433|Sugar_tr| HM:PFM:NREP 1 HM:PFM:REP 24->443|PF00083|1.3e-36|20.2|405/451|Sugar_tr| GO:PFM:NREP 4 GO:PFM GO:0005215|"GO:transporter activity"|PF00083|IPR005828| GO:PFM GO:0006810|"GO:transport"|PF00083|IPR005828| GO:PFM GO:0016021|"GO:integral to membrane"|PF00083|IPR005828| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00083|IPR005828| RP:SCP:NREP 1 RP:SCP:REP 20->407|1pw4A|3e-08|13.1|367/434|f.38.1.1| HM:SCP:REP 2->443|1pw4A_|2.9e-65|26.3|414/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 2764 OP:NHOMOORG 515 OP:PATTERN ------4768887684-6232321-------------------------------------113---- -1--131688C-2154422-27--1U2222215999DNno--224-1-1441PJL626-----338Q77311111222-13-B--111--------1--1-2---2-2-2-----------------1-1---1-------11111--------------131---------1-----1-----1--------1222222211222222------222-23--1-------1-1111111111111111-112----22-2-----11-1---11--------------------------------------------------------------------------------------------------1--44461442452F551-32323244444443435-66B55G7D221-666622444544B4-----5-----1-32333333455121-1442334441122569B75F5575573233-1564-63345WPPWRSCFHHDXXbNKMKICIXJZAIFB-5GD932622611-8436---1141-------11--1-1--1----21--------------111111-----1-5455341-2222212-------1-1---------------1--------------1---------77782774668577755-665567555667555455678766--28778788887778787944643441-333332233332----11111575711-11---1---22211--288989571125-AAC9CDD91FGGG-B9A955449555----------1----55545444451111---------------------------------------------------------1- ----------------------------------------------------------------1---------------------------------------1---6------------------------------------------------------3------------11-----1----1---231---1 --------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------- DISOP:02AL 1-18, 226-240, 438-459| PSIPRED cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccccccccccccccccc //