[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57720.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:512 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->118 PF10099 * RskA 1.9e-05 17.9 84/175  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57720.1 GT:GENE BAD57720.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3059611..3061149) GB:FROM 3059611 GB:TO 3061149 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57720.1 LENGTH 512 SQ:AASEQ MLTGCANNVLRLNPPSASAGRRCRSNVGQTPSDDTVTVFSTCTRPRSRADSGHHTTGRNMRTFRWSTPVGIAVAATVLVAGSACTNTPPPRTAQTTTTAPTTTTATPTPTSAGPVTVANPKHLPVSFGRGVMAWHCNQQFSGPGKPGPAVLRLSHNPNRAYEIPAPTVPNETVDQGDSDSCATTGEGSDLRVVYAATSFKASSGLEPEAHSLSLISYRLGQSAPATRVTVWSGRDRPVAVSLRGTASGVAVSFDIYGMNSPQVKGYEGTDLREAWSMPGTVAASTNKTYVVTTPGECTACPDKWVILAANGSVLHEPPTTIAVPLDLVTDYGYGLETPDGMLWFDEAAGRIPDGAAGALRNAGGLLPDPMTPMIVVKYSEAGKPMFKVLDRTTWQELLVVDADRTAGLRIDSVALYDGHLYIRNSSDSPVIRVSDSQVVAKGWQVLPVGRIGDTTVLAHAPAAIGSSNCVEDTLVLDGTSHHPGTPNVYGLSTCTEFTVVPDVDGMFPGPRY GT:EXON 1|1-512:0| SEG 85->116|tntppprtaqttttapttttatptptsagpvt| SEG 354->366|gaagalrnaggll| HM:PFM:NREP 1 HM:PFM:REP 17->118|PF10099|1.9e-05|17.9|84/175|RskA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 17-27, 47-54, 511-512| PSIPRED ccccccccEEEEcccccHHHHHHHHHccccccccEEEEEEEccccHHccccccccccccEEEEEEccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEcccccccccccccEEEEEcccccccccccccEEEEEEcccccEEEccccccccHHHccccccccEEccccccEEEEEEEEccccccccccccccEEEEEEEcccccccEEEEEEccccccEEEEEccccccEEEEEEEEEcccccccccccccHHHHHccccEEEEccccEEEEEcccccccccccEEEEEEcccEEEccccEEEEEHHHHHcccccccccccEEEEEcccccccccHHHHHHHcccccccccccEEEEEEcccccHHHHHHHHcccEEEEEEEccccccEEEEEEEEEEcEEEEEccccccEEEEcccEEEEcccEEEEEcccccEEEEEEcccccccccccccEEEEEccccccccccEEEEcccEEEEEEcccccccccccc //