[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57727.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.69.11b.69.4
:410 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   301->408 2h9lA PDBj 1e-07 35.3 %
:RPS:PDB   174->408 1e2rB PDBj 5e-12 11.9 %
:RPS:SCOP  279->408 1k8kC  b.69.4.1 * 2e-11 19.3 %
:HMM:SCOP  111->410 1ri6A_ b.69.11.1 * 2.6e-19 26.7 %
:BLT:SWISS 130->408 HETE1_PODAN 1e-08 29.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57727.1 GT:GENE BAD57727.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3065562..3066794) GB:FROM 3065562 GB:TO 3066794 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57727.1 LENGTH 410 SQ:AASEQ MHEIDPQPLLTRRRAILGGTALTLAVTGAGALGINLTDVDAAGEAGPASPSATPAGQTGSWLSLSPRDNKPLRAVLFAYDDGFRRAHLAFSNDGSTLTMARLPTHGTGIDVQVWSLEQESRIKSGTLDLGRFGAFAVGPEGVAYRDEHCIGIWRRTKPLSTSASVQCGQKNGSTTVALSDDGTRLAASVTYAPGGTGGPNRNYLDIWGVNPPELLHSTHLPYQPHTLKFSDANRILAHAGRSGEYGEAGTHPLVGFIDIAQKSTRPELTDIAADNPDRHARNVDDFDMSADGSMIAISLSDPLSNPMGNPLFDEVQVWDVNARSPITILRGKGGAVEFTRQGDLLATGTFDGYGLDIWDIRRRTARRSLNLTAAPEAARGLNGSVAFSPDGRHLAVPVGRTVQLWDVSLM GT:EXON 1|1-410:0| BL:SWS:NREP 1 BL:SWS:REP 130->408|HETE1_PODAN|1e-08|29.4|252/1356| SEG 17->33|lggtaltlavtgagalg| SEG 41->56|aageagpaspsatpag| BL:PDB:NREP 1 BL:PDB:REP 301->408|2h9lA|1e-07|35.3|102/321| RP:PDB:NREP 1 RP:PDB:REP 174->408|1e2rB|5e-12|11.9|185/543| RP:SCP:NREP 1 RP:SCP:REP 279->408|1k8kC|2e-11|19.3|114/354|b.69.4.1| HM:SCP:REP 111->410|1ri6A_|2.6e-19|26.7|258/0|b.69.11.1|1/1|Putative isomerase YbhE| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 323 STR:RPRED 78.8 SQ:SECSTR #######################################################################################cccTTccccEEEETTccccccEEEEEEEEETTEEEEEEEEEEcccEEEEEEETTEEEEETTEEEEEcTTccEEEcTTTEEEEccccccccccTTcccccEccccccEEHHHHHHHHHHHHHHHTHHHHcTTcccccEcccccccccHHHHHHHcHHHHEEEEEEEEHHHHHHccTTTcccHHHTTcccTTTHccccHHHHHHHHHHHHccccccccEEEEccEEEccccHHHHHHHcEEcccGGGcccccccGGGEEEEEEGGGTEEEEEEETTTccEEEEEEccccEEcccTTEEEEEEcTTccEEEEEETcEEEEEETTEE DISOP:02AL 1-5, 8-9, 35-36, 38-61| PSIPRED ccccccccccccEEEccccEEEEEEEEcccccccccccccccccccccccccccccccccEEEEccccccccEEEEEEEEEcccccEEEEcccccEEEEEEccccccccEEEEEEcccccEEEEEEcccccEEEEEEcccEEEEEcccEEEEEEccccccEEEEEEEcccccEEEEEEcccccEEEEEccccccccccccccEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEccccEEEEEEEcccccEEEEEEcccccccccccEEEEEEcccccEEEEEEccccccccccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEccccEEEEEEccccEEEEEEEEcccccccccEEEEEEEcccccEEEEEEccEEEEEEEEEc //