[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57729.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:373 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->225 3ds8A PDBj 2e-10 9.7 %
:RPS:SCOP  7->140 1cvlA  c.69.1.18 * 9e-08 24.1 %
:HMM:SCOP  2->232 1ji3A_ c.69.1.18 * 1e-19 19.8 %
:HMM:PFM   64->128 PF07819 * PGAP1 1.3e-06 21.7 60/225  
:BLT:SWISS 2->232 SRAC1_DANRE 3e-05 28.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57729.1 GT:GENE BAD57729.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3067937..3069058) GB:FROM 3067937 GB:TO 3069058 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57729.1 LENGTH 373 SQ:AASEQ MPTTIGLVTVHGILSSSRTWQPMTELLRADPEISGRVSFLPFEYPTRLINMSVQRKIPDFDELARYLETALREEFDPNQPVIVLAHSQGGLIVQRYLALQLDHGQAERLQRIRRIMMFATPNSGSEFMLSARKWLLRNPQERDLRPLSSKIFETQQKVLQQIVYAQEPTSSSVPIEIEAFAGIEDRIVLPQSAASVFRFSGTLPGDHSSIIKPTAATDLVYRVVKSRIQSALEHHDGAGASKSEARDELPLLKASHDSVTEPTAGCTAESARRIASALAEVPTLRNPVARVQLGMELPPYIQERAPVGSGNARLDLVTLVRVCAEFGRTGREALVVSLEFGFPDDPMLRQALKVIRAEWPQSDDEDTMTRTEP GT:EXON 1|1-373:0| BL:SWS:NREP 1 BL:SWS:REP 2->232|SRAC1_DANRE|3e-05|28.1|224/100| RP:PDB:NREP 1 RP:PDB:REP 7->225|3ds8A|2e-10|9.7|216/245| HM:PFM:NREP 1 HM:PFM:REP 64->128|PF07819|1.3e-06|21.7|60/225|PGAP1| RP:SCP:NREP 1 RP:SCP:REP 7->140|1cvlA|9e-08|24.1|116/316|c.69.1.18| HM:SCP:REP 2->232|1ji3A_|1e-19|19.8|217/0|c.69.1.18|1/1|alpha/beta-Hydrolases| OP:NHOMO 7 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------------------3---------------------------1-----------------------------------------------------------------1----1---------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 219 STR:RPRED 58.7 SQ:SECSTR ######EEEEccTTccTTTTHHHHHHHTTcEEEETTTEEEEEccccTTccccEEEEEEccTTHHHHHHHHHHHHHHHcccEEEEEETHHHHHHHHHHHHcHHcTTcTTccEEEEEEEEcccTTcccHHHHccTTccccccccHHHHHHHTGGGccTTcEEEEEEEEccTTccccccccHHHHTGGGGTcTTccEEEEEEEEcGGGcGGGGGGcHHHHHHHHHHHH#################################################################################################################################################### DISOP:02AL 234-246, 261-270, 367-373| PSIPRED ccccccEEEEEcccccHHHccHHHHHHHHHHHHcccEEEEEEcccEEEEEccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEcHHHHHHHHHHHHcccccHHHHHHHHcEEEEEEcccccHHHHHHHHHHHHccHHHHHHHcccHHHHHHHHHHHHHHHHHHHcEEEEEEEEEccccccccccccccccccccccEEEEccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHccccccccccHHHHHHHHHHHHccccHHHEEEEHcccccccHHHHHHHHHHHHHccccccccccccccc //