[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57733.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:158 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   71->149 PF08317 * Spc7 0.0006 11.4 79/326  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57733.1 GT:GENE BAD57733.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3071915..3072391 GB:FROM 3071915 GB:TO 3072391 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57733.1 LENGTH 158 SQ:AASEQ MFHDACGRNWNHGLPHYRCRYPSEYALANNLDHPTTVYLREDQLSGPIDSRLAEIFHPDRIEHSLTMLDDAQTDNMPAIESARRSLAEHDRKLSRYRAALEAGTDPALVADWTQQVQRERQATAAQLSALEAAQHSDQCMTKEEVHQLVTSLGGWSTY GT:EXON 1|1-158:0| SEG 121->134|qataaqlsaleaaq| HM:PFM:NREP 1 HM:PFM:REP 71->149|PF08317|0.0006|11.4|79/326|Spc7| OP:NHOMO 6 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1------2-----------------1----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 84-86| PSIPRED cccccccccccccccccccccccHHHHHccccccEEEEEEcccccccHHHHHHHHHccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccc //