[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57734.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:144 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   27->101 PF07681 * DoxX 3.1e-09 35.1 74/85  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57734.1 GT:GENE BAD57734.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3072987..3073421 GB:FROM 3072987 GB:TO 3073421 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57734.1 LENGTH 144 SQ:AASEQ MTTTTATSFATDAARRPGTIRNRVLWTLQIVLGLFFIIASGGPKLVMPNALVENAPENLTLPFGLLIFIGLAEVAGGIGLMVPRLTALAAVGLSVLTVLAAGTQAFIADKPAMAIFPLVLAAIFAWIAYERRAGLTALRTAFSR GT:EXON 1|1-144:0| TM:NTM 4 TM:REGION 23->45| TM:REGION 59->81| TM:REGION 86->108| TM:REGION 114->130| SEG 2->14|ttttatsfatdaa| HM:PFM:NREP 1 HM:PFM:REP 27->101|PF07681|3.1e-09|35.1|74/85|DoxX| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccEEccHHHHHcccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcc //