[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57735.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:83 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->52 PF11839 * DUF3359 0.00076 29.5 44/96  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57735.1 GT:GENE BAD57735.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3073370..3073621) GB:FROM 3073370 GB:TO 3073621 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57735.1 LENGTH 83 SQ:AASEQ MAVVGWEAAGTPHPTESGRPVRHPKAGAANRTAADRTAANPTGDRSRKRADRRSVDPPIADQRSGRCHRENAVRRAVRPARRS GT:EXON 1|1-83:0| SEG 26->40|agaanrtaadrtaan| SEG 72->82|avrravrparr| HM:PFM:NREP 1 HM:PFM:REP 9->52|PF11839|0.00076|29.5|44/96|DUF3359| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-28, 30-31, 34-59, 80-83| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccHHHHHHHHHHHcccc //