[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57740.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:82 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   15->72 PF07332 * DUF1469 0.0002 26.9 52/121  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57740.1 GT:GENE BAD57740.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3076827..3077075) GB:FROM 3076827 GB:TO 3077075 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57740.1 LENGTH 82 SQ:AASEQ MARSPDPDTVDDTVAPLGVPAMITALGMLAAALLTADRLPDWADDYGGALVYVAGALYVAVSVRLLWWGRTARAVRVRRRAR GT:EXON 1|1-82:0| TM:NTM 2 TM:REGION 14->36| TM:REGION 45->67| SEG 5->14|pdpdtvddtv| SEG 21->36|amitalgmlaaallta| SEG 46->61|yggalvyvagalyvav| SEG 70->81|rtaravrvrrra| HM:PFM:NREP 1 HM:PFM:REP 15->72|PF07332|0.0002|26.9|52/121|DUF1469| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 80-82| PSIPRED cccccccccccHHHccccHHHHHHHHHHHHHHHHHHHccccccHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcc //