[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57742.1
DDBJ      :             putative two-component system response regulator
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  734/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:215 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->212 3c3wA PDBj 2e-61 64.9 %
:RPS:PDB   1->205 3c3wB PDBj 2e-33 67.6 %
:RPS:SCOP  3->194 1s8nA  c.23.1.1 * 1e-19 23.1 %
:RPS:SCOP  165->208 1fseF  a.4.6.2 * 7e-12 34.1 %
:HMM:SCOP  1->185 1s8nA_ c.23.1.1 * 3.1e-28 29.5 %
:RPS:PFM   4->116 PF00072 * Response_reg 2e-08 29.7 %
:RPS:PFM   150->200 PF00196 * GerE 2e-09 52.9 %
:HMM:PFM   4->116 PF00072 * Response_reg 1e-29 33.0 112/112  
:HMM:PFM   149->205 PF00196 * GerE 2.9e-20 40.4 57/58  
:BLT:SWISS 1->207 YFIK_BACSU 2e-32 33.3 %
:PROS 165->192|PS00622|HTH_LUXR_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57742.1 GT:GENE BAD57742.1 GT:PRODUCT putative two-component system response regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3078982..3079629) GB:FROM 3078982 GB:TO 3079629 GB:DIRECTION - GB:PRODUCT putative two-component system response regulator GB:PROTEIN_ID BAD57742.1 LENGTH 215 SQ:AASEQ MVRVFLVDDHAIVRRGVADLIDAEADMEVVGEAADAAQALARIPALDPDVAVLDVRLPDGNGIELCRELLSRDGKLRCLILTSFTDEQAMLDAILAGASGYVVKDIGTTDLVDAVRAIGAGKSLLDNRAAAALMAKLRAEAEADTGPLAALTEQERTLLALLGEGLTNRQIAARMFLAEKTVKNYVSRLLTKLGVERRTQAAVLAAKLEQPRRTD GT:EXON 1|1-215:0| BL:SWS:NREP 1 BL:SWS:REP 1->207|YFIK_BACSU|2e-32|33.3|207/220| PROS 165->192|PS00622|HTH_LUXR_1|PDOC00542| SEG 128->143|raaaalmaklraeaea| BL:PDB:NREP 1 BL:PDB:REP 1->212|3c3wA|2e-61|64.9|211/211| RP:PDB:NREP 1 RP:PDB:REP 1->205|3c3wB|2e-33|67.6|204/210| RP:PFM:NREP 2 RP:PFM:REP 4->116|PF00072|2e-08|29.7|111/111|Response_reg| RP:PFM:REP 150->200|PF00196|2e-09|52.9|51/57|GerE| HM:PFM:NREP 2 HM:PFM:REP 4->116|PF00072|1e-29|33.0|112/112|Response_reg| HM:PFM:REP 149->205|PF00196|2.9e-20|40.4|57/58|GerE| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 2 RP:SCP:REP 3->194|1s8nA|1e-19|23.1|186/190|c.23.1.1| RP:SCP:REP 165->208|1fseF|7e-12|34.1|44/50|a.4.6.2| HM:SCP:REP 1->185|1s8nA_|3.1e-28|29.5|183/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 4247 OP:NHOMOORG 763 OP:PATTERN -----------------------11-----12---2--2222112-2312113-2-2121-------- BFJ4m75655432575533-37117D333334DA9ADKJL7F8VHQD67DC8688658117AG7aDNVkYB4444822-3418--11111----11---4-6123H4I43-------------------1------DDEDB778K9A4583321133-11131562BCBE--1---1-2----6763222259B666668875866887DDEE6C6985889934554554Lc444444434444444344432---22-1--1221222221-1-111122232343344444444444111111211111153322222328C3AA333344324283333111835--H3234975555683421661-1A215223-----27I6C3155567933333333333-76969B86184-8335434674764331242475564343333333312212935------------------------------1241-442138459854555377DH7778276BCEEKG-1BB9CD7658A8BA37938858621111111123A9A43521264173332162983774555657551--------------------2--12--76165385742665773866875646958A--1-543------95455957886765677-8777767777867667667777665539789999999899999676766763-766666566666--444444411111383411111211111-112222222223245DCFDCE9EDAAA87A88---------233354555547387DA97B7666722221131664444--------3---------------------------12222222223K- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1-----------2--2-----4---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 212 STR:RPRED 98.6 SQ:SECSTR cEEEEEEcccHHHHHHHHHHHHTcTTEEEEEEEccHHHHHHHHHHHcccEEEEccEETTEEHHHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGGGccHHHHHHHHHHHHHHHHHcEcTTTTccHHHHHHHHHHTTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccccHHHHHHHHHTTTc### DISOP:02AL 133-150, 212-215| PSIPRED cEEEEEEccHHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccEEEcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccc //