[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57745.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:142 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   12->141 PF04075 * DUF385 1e-19 48.0 %
:HMM:PFM   11->139 PF04075 * DUF385 1.3e-34 36.3 124/132  
:BLT:SWISS 15->141 Y1292_MYCBO 9e-15 41.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57745.1 GT:GENE BAD57745.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3081859..3082287) GB:FROM 3081859 GB:TO 3082287 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57745.1 LENGTH 142 SQ:AASEQ MSDGKDWNTSIIEEFRANEGRVGGQFAGAPMLLLHHRGRKSGREMVAPLMYQADENDPDTVYVFASKAGAPVDPEWYHNLRAAGRAEIERGTDRYAVTVEVVTGAERDRIYAEQARRYPGFADYERQTAGIRTIPVVALRRA GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 15->141|Y1292_MYCBO|9e-15|41.2|119/149| RP:PFM:NREP 1 RP:PFM:REP 12->141|PF04075|1e-19|48.0|125/130|DUF385| HM:PFM:NREP 1 HM:PFM:REP 11->139|PF04075|1.3e-34|36.3|124/132|DUF385| OP:NHOMO 151 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- ----1---------46744-45--4844444358886362-51722--------------22--2-3122------------------------------------------------------------------1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccHHHHHHHHHHHHHHcccEEEEEEccccEEEEEEccccccccEEEEEEEEcccccccEEEEEEccccccccccEEEEEccccEEEEEEccEEEEEEEEEcccccHHHHHHHHHHHcccHHHHHHHHccccEEEEEEEEcc //