[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57747.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:162 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57747.1 GT:GENE BAD57747.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3082997..3083485 GB:FROM 3082997 GB:TO 3083485 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57747.1 LENGTH 162 SQ:AASEQ MNNVGVVITEAHRAENELGTELLRVADRQLTDHEVHHLAGDLARWSHQHVRALAVTGRRFGLDLDPEPEHDSALRAAVRQKGSELLGRHHTPALLLLRDLRRIHVLAAGVSLDWELLAQAAQAMRDSDLLALTQRCHPQTLRQMRWANAKLKESAPQIVVTG GT:EXON 1|1-162:0| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ----1----------11--------1----------1-------------------------1--1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccc //