Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57750.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:163 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57750.1 GT:GENE BAD57750.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3085988..3086479) GB:FROM 3085988 GB:TO 3086479 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57750.1 LENGTH 163 SQ:AASEQ MPEYRQLAYTDELLADGTVHRRYADGRQEWRSRGPDGTVGWRDDRGHSGTDEPLGSKLVKRVHRGGTVVYGRESGYGRTLWSDGVLTVNRSSFGGRLGGILAAVAGGALLGALIMPPTSLTPEEEEELRAQAAQTGTGGGDADGGDGGYDDWDDGYGDDDDFG GT:EXON 1|1-163:0| SEG 94->113|ggrlggilaavaggallgal| SEG 123->127|eeeee| SEG 136->162|gtgggdadggdggyddwddgygddddf| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1---------------------------------------------------------------------------------------------------1--11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 123-142, 158-163| PSIPRED cccHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHccccEEEEcccccccEEEcccEEEEEccccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccccccccccccccccccccccc //