[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57753.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  127/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:205 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->160 3hnrA PDBj 5e-10 33.8 %
:RPS:PDB   16->183 3bkwA PDBj 1e-16 22.6 %
:RPS:SCOP  8->128 2i6gA1  c.66.1.44 * 7e-21 28.3 %
:HMM:SCOP  1->203 1xvaA_ c.66.1.5 * 6.2e-34 30.0 %
:RPS:PFM   33->125 PF08241 * Methyltransf_11 7e-16 43.0 %
:HMM:PFM   33->125 PF08241 * Methyltransf_11 2.4e-26 45.2 93/95  
:BLT:SWISS 11->203 Y092_MYCBO 9e-34 42.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57753.1 GT:GENE BAD57753.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3088429..3089046 GB:FROM 3088429 GB:TO 3089046 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57753.1 LENGTH 205 SQ:AASEQ MTQLPPDTDRWNTNIHYHDVLVEAVAPHAGRILDVGCGEGMLCRRLRRDDRAIVGIDTHAESIALARAQSGADGPDYLCADVLTHPFEPASFDAIVSVATLHHLDPDAALTTMARLLKPGGTLAIVGLARPRWPHDLPVEALAVLAFTYHRLAGHRHWEHPSPIVWPPPHTYAEIRDTARALLPGVRYRRHLYWRYSLRWRKPAD GT:EXON 1|1-205:0| BL:SWS:NREP 1 BL:SWS:REP 11->203|Y092_MYCBO|9e-34|42.1|190/197| BL:PDB:NREP 1 BL:PDB:REP 16->160|3hnrA|5e-10|33.8|136/193| RP:PDB:NREP 1 RP:PDB:REP 16->183|3bkwA|1e-16|22.6|168/215| RP:PFM:NREP 1 RP:PFM:REP 33->125|PF08241|7e-16|43.0|93/96|Methyltransf_11| HM:PFM:NREP 1 HM:PFM:REP 33->125|PF08241|2.4e-26|45.2|93/95|Methyltransf_11| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF08241|IPR013216| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF08241|IPR013216| RP:SCP:NREP 1 RP:SCP:REP 8->128|2i6gA1|7e-21|28.3|120/177|c.66.1.44| HM:SCP:REP 1->203|1xvaA_|6.2e-34|30.0|203/292|c.66.1.5|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 191 OP:NHOMOORG 146 OP:PATTERN ----------------------1------1-1-----------2--11----11---1---------- -12-2---11----31111-1---321111122---11-1-2121-21------1-1---12--3121321---------------------------------1----------------------------------11----3-------11--------1-1---1---------------1-----------------------11---------------------1-25-2-----222----3--------------------------------------------------------------------------------------------------------1---------1-------------------1-221------------------------------1-111112-111--------------------------------1------------------------------1----------11-1-1------1------12-1------11---1-1--------------1-------------12---1---11--------1---------1------------------------------------1---11-----------1---------111-------------------------------------------111-----------------------------1----------------------1111-------------------------------1-------------------------------------------11111---1111--1-11---------------------------------------------------1- -----------------------------------------------------------------------------------------111----------------3--------------------------------------------------21-------------1---1--22---------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 205 STR:RPRED 100.0 SQ:SECSTR HHEETTccTTTcccHcTTHHHHHHccccTTEEEEETcTTcHHHHHHHHTTccEEEEEEccHHHHHHHHTcccccEEEEEccGGGccccTTcEEEEEEEccGGGccHHHHHHHHHHHEEEEEEEEEEEEcHHHHccccccEEcTTccEEcccccTTccEEEcTTHHHHcccEEEccHHHHHHHHcccEEEEEEEEcEEcccccTTc DISOP:02AL 204-205| PSIPRED cccccccccHHHccHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHcccEEEEEEccHHHHHHHHHHccccccEEEEccHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccHHHHHHcccEEEEEEEcccc //