[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57755.1
DDBJ      :             putative translocator
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  120/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:207 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   68->203 PF01810 * LysE 2e-09 34.6 %
:HMM:PFM   11->204 PF01810 * LysE 1.9e-34 25.9 189/192  
:BLT:SWISS 5->143 RHTB_SHIFL 4e-08 23.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57755.1 GT:GENE BAD57755.1 GT:PRODUCT putative translocator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3091158..3091781) GB:FROM 3091158 GB:TO 3091781 GB:DIRECTION - GB:PRODUCT putative translocator GB:PROTEIN_ID BAD57755.1 LENGTH 207 SQ:AASEQ MSIEFVLTTLVVVATPGTGALFTLATALSRGARAGLVAALGCTLGIVPHLLAAITGLAALLHTSALAFQTVKYLGVAYLLYMAWSVVRDTGSPTLPTGEPATGTPRSAARVVGAAVLLNLLNPKLTVFFVAFLPQFVPAGTPRASLRMLELGAVFMLATFVVFAAYGIGAATLRGRVLHRPAVLAWTRRTFAVSFLAMAGRLAVQDR GT:EXON 1|1-207:0| BL:SWS:NREP 1 BL:SWS:REP 5->143|RHTB_SHIFL|4e-08|23.7|135/206| TM:NTM 6 TM:REGION 4->26| TM:REGION 39->61| TM:REGION 65->87| TM:REGION 112->134| TM:REGION 153->174| TM:REGION 180->202| SEG 27->41|alsrgaraglvaalg| SEG 50->61|llaaitglaall| SEG 108->121|aarvvgaavllnll| RP:PFM:NREP 1 RP:PFM:REP 68->203|PF01810|2e-09|34.6|130/190|LysE| HM:PFM:NREP 1 HM:PFM:REP 11->204|PF01810|1.9e-34|25.9|189/192|LysE| GO:PFM:NREP 2 GO:PFM GO:0006865|"GO:amino acid transport"|PF01810|IPR001123| GO:PFM GO:0016020|"GO:membrane"|PF01810|IPR001123| OP:NHOMO 188 OP:NHOMOORG 125 OP:PATTERN ----------------------------1-------------1--------11--------------- ----1---------------------------1---2----------------11-----------3-----------------------------------------------------------1------1----------1-----------------------------------------------------------------1--------221---------2-----------------------------------------------------------------------------------------------------------------------------------------------------------411---21111----------1---------13---111--121111-----11-1-11111-------------1--------------------------------------22124554542111133331111124221111--322-1-1----11---1--1-1---------------11-1-1---1-------212-11----1------------------------1-------3------1-------------------1---------------11---------------------------------1---1-------------------1------------------------------------211---------------------111-------1211-----1-1--------------1-------2-------------------------------------------------------------------------1- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 89-109| PSIPRED cHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcc //