[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57758.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  277/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.17.1
:175 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->175 1fuxB PDBj 6e-31 41.9 %
:RPS:PDB   7->168 1behB PDBj 7e-17 18.2 %
:RPS:SCOP  4->173 1wpxB1  b.17.1.1 * 4e-26 14.6 %
:HMM:SCOP  14->177 1fuxA_ b.17.1.2 * 1.8e-54 36.6 %
:RPS:PFM   41->163 PF01161 * PBP 8e-07 39.8 %
:HMM:PFM   36->174 PF01161 * PBP 2.3e-36 40.2 127/146  
:BLT:SWISS 4->175 Y2164_MYCBO 2e-57 58.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57758.1 GT:GENE BAD57758.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3093742..3094269 GB:FROM 3093742 GB:TO 3094269 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57758.1 LENGTH 175 SQ:AASEQ MAYNPYDALPQVPTFTVTSQDVTDGQPFASEQVSGVMGAGGKDISPQLSWSGFPPETKSFAVTVFDPDAPTASGFWHWAVCDIPADVTSIPSGAADNDAGLPTGSLTLRNDAGSYGYVGAAPPPGHGPHRYFIVVHAVDTERLGLDKNTTPAVLGFNLFSHTLARGTIVATYEQK GT:EXON 1|1-175:0| BL:SWS:NREP 1 BL:SWS:REP 4->175|Y2164_MYCBO|2e-57|58.5|171/176| SEG 119->129|gaapppghgph| BL:PDB:NREP 1 BL:PDB:REP 15->175|1fuxB|6e-31|41.9|160/163| RP:PDB:NREP 1 RP:PDB:REP 7->168|1behB|7e-17|18.2|132/183| RP:PFM:NREP 1 RP:PFM:REP 41->163|PF01161|8e-07|39.8|113/143|PBP| HM:PFM:NREP 1 HM:PFM:REP 36->174|PF01161|2.3e-36|40.2|127/146|PBP| RP:SCP:NREP 1 RP:SCP:REP 4->173|1wpxB1|4e-26|14.6|157/204|b.17.1.1| HM:SCP:REP 14->177|1fuxA_|1.8e-54|36.6|164/165|b.17.1.2|1/1|PEBP-like| OP:NHOMO 369 OP:NHOMOORG 286 OP:PATTERN -----1----------1-----------------1---------1-----------1-1-1---1--- ----311111121211111-1111111111111111111112111111-111--11-1--11112231211------------112-1--------1----11--2---------------------------1-----11----1----22-1-------------1-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1----------1111---1--------------2--1-------11-22211111-------1-------11111111111---1-------------1-11-1--1-----------1-------211112222231152222222212-1----------11---1----1----12---11----------1--1--------1------11-----111-1-----------------------1--11--112-----1111--3111--22---1----1--------11112-12112222212-1122112112221222221222-----2121222222212112211122121----------------------11-1--211-----1--------------------1-----11-1-111---------------11-1111111111--11111111----------1111----------------------------------------------1-- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 171 STR:RPRED 97.7 SQ:SECSTR ####cGcccccEEccEEEcEEccTTEEccTTTTccETTEEcccccccEEEcTTccTTcEEEEEEEEccccccccEEEEEEEEEETTcGGGcEEEEccccccccTcEcGGGcEEEEccccccccTTcccEEEEEEEEEcccccccccccccccccTTcccccHHHHHHHcEEEccc DISOP:02AL 1-3| PSIPRED cccccccccccccccEEEEccccccccccHHHccccccccccccccEEEEEccccccEEEEEEEEEccccccccEEEEEEEcccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEEEEEcccccccccccccHHHHHHHHHHcEEEEEEEEEEEEEc //