[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57764.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:84 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   56->73 PF00468 * Ribosomal_L34 0.00056 55.6 18/44  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57764.1 GT:GENE BAD57764.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3100604..3100858) GB:FROM 3100604 GB:TO 3100858 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57764.1 LENGTH 84 SQ:AASEQ MASRSSRTALPAGWETGSDSDDYEYVPLRLPKDVTRVTASMRLAIQAEFGGWELSRVRAYTDGSRKVLLRRRKSALLPQPEPGM GT:EXON 1|1-84:0| HM:PFM:NREP 1 HM:PFM:REP 56->73|PF00468|0.00056|55.6|18/44|Ribosomal_L34| OP:NHOMO 24 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- --------------111----11111----1111111111----1---------------11--111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13, 79-84| PSIPRED ccccccccccccccccccccccEEEEEEEEcccccccccEEEEEEccccccEEEEEEEEEEcccEEEEEEEccccccccccccc //