[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57767.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:178 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   108->129 PF07151 * DUF1391 0.00055 61.1 18/49  
:HMM:PFM   9->62 PF10738 * Lpp-LpqN 0.00046 25.5 47/241  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57767.1 GT:GENE BAD57767.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3102407..3102943 GB:FROM 3102407 GB:TO 3102943 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57767.1 LENGTH 178 SQ:AASEQ MHSTRSTRTALAAAALLTVGVAAACSSGPDEAAVDAARSKAVAALSSSAAATSSEIANRHIPTAAELDAQIKRALDPALPDSERTALIEDGEAFRDAIPDMYRALQDNPRAVYGVTDPVFDNRDGTLTATMKLDKDGTGTAVRTTVVHFVYLDGRWKISRTDLCGILRSADYRTPACG GT:EXON 1|1-178:0| SEG 9->24|talaaaalltvgvaaa| SEG 32->57|aavdaarskavaalsssaaatsseia| HM:PFM:NREP 2 HM:PFM:REP 108->129|PF07151|0.00055|61.1|18/49|DUF1391| HM:PFM:REP 9->62|PF10738|0.00046|25.5|47/241|Lpp-LpqN| OP:NHOMO 7 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2122----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHcccccEEEEEEccccccccccEEEEEEEEEccccccccccEEEEEEEcccEEEEHHHHHHHHHHccccccccc //