[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57771.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  112/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:293 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->165 2zcvA PDBj 3e-13 29.4 %
:RPS:PDB   2->65 3c3xA PDBj 4e-08 21.9 %
:RPS:SCOP  2->143 1xq6A  c.2.1.2 * 6e-20 28.9 %
:HMM:SCOP  2->253 1k6xA_ c.2.1.2 * 2.5e-48 37.3 %
:RPS:PFM   2->157 PF05368 * NmrA 1e-17 45.9 %
:HMM:PFM   2->186 PF05368 * NmrA 2.1e-21 32.8 180/233  
:BLT:SWISS 1->165 AZOB_XENAZ 6e-18 37.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57771.1 GT:GENE BAD57771.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3106209..3107090 GB:FROM 3106209 GB:TO 3107090 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57771.1 LENGTH 293 SQ:AASEQ MILVTGATGSIGSHLVRALHRDGTPLRALVRHDAGGRALGCDYVVGDFDDPRSLAAALDGVDRLFLNSTGAIPVDGEQPMIRWHRAAIDAARAAGVEHVVKVSVWHAAPGAPLSRGAHFATDEYLKASGLGWSLLRPTGYMQNFLSPAAFTADGKLVASYGEAPVAYIDCRDIAACAAALLTAPAPGSYELTGPAALTDADIAATLATALDQPVSCAPLPATALAAALAGRGLPPRFAADLAVLVGEVADGDQSTTTSTVADLTGHPPRTFARFATDHRPALLAALEAARSQP GT:EXON 1|1-293:0| BL:SWS:NREP 1 BL:SWS:REP 1->165|AZOB_XENAZ|6e-18|37.7|159/286| SEG 85->94|raaidaaraa| SEG 166->186|ayidcrdiaacaaalltapap| SEG 195->211|aaltdadiaatlatald| SEG 217->236|aplpatalaaalagrglppr| SEG 281->289|allaaleaa| BL:PDB:NREP 1 BL:PDB:REP 1->165|2zcvA|3e-13|29.4|160/283| RP:PDB:NREP 1 RP:PDB:REP 2->65|3c3xA|4e-08|21.9|64/310| RP:PFM:NREP 1 RP:PFM:REP 2->157|PF05368|1e-17|45.9|148/234|NmrA| HM:PFM:NREP 1 HM:PFM:REP 2->186|PF05368|2.1e-21|32.8|180/233|NmrA| RP:SCP:NREP 1 RP:SCP:REP 2->143|1xq6A|6e-20|28.9|142/253|c.2.1.2| HM:SCP:REP 2->253|1k6xA_|2.5e-48|37.3|241/350|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 129 OP:NHOMOORG 114 OP:PATTERN -------------------------------------------------------------------- 1-1-2---111-------------------------12-1-1-21------1-11-----11--3-1-12-----------------------------------1----------------------------1-------------21--1--11------11-31--1-----------------------------------1----11------1----1---------------------------------------------------------------------------------------------------------------------------------------------------11----1-------------------------------11-12--1-2---111-1111211-------1--------------------------------------------------------------------------------------------------1------1----------------------------------------------------3------------------------------------------------------------------------1-1--1-1111111111-11111111111111111111111---------------------1111111--1--------------------------1----------------------------1-------------------------------------------1-2--111--------------------------------------------------------------- ------------------------------------------------------------------1-----------------------1------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 165 STR:RPRED 56.3 SQ:SECSTR cEEEETTTcTTHHHHHHHHHHTTccEEEEEcTTcccHHHHHHHHHTTcEEEEccTTcHHHHHHHHEccccccccccHHHHHHHHHHHHHHHHHTTccEEEEEccccccTTcccTHHHHHHHHHHHHHHccEEEEEEEETTHHHHEGGGGcccccHHHHHHHHccc################################################################################################################################ DISOP:02AL 289-293| PSIPRED cEEEEccccHHHHHHHHHHHHcccEEEEEEcccHHHHccccEEEEEccccHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccccccHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHccccEEEccccccccEEEHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHccccEEEEccHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHccccccc //