[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57772.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:156 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   142->154 PF05901 * Excalibur 9.9e-07 69.2 13/37  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57772.1 GT:GENE BAD57772.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3107167..3107637) GB:FROM 3107167 GB:TO 3107637 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57772.1 LENGTH 156 SQ:AASEQ MPGRALRILAAPLVCAAVSVSACGDLSGPAPTTHHSTSTPVPASHPSSTAAAAPSTSPAPAPTSTSSPTAAPATPRPAPPSPAQQPPPPPAVAPPLPAAPGPSCHPSYDPCVPITSDVDCSGGSGNGPAYTGRVRVVGPDEYDLDRDNDGIGCESG GT:EXON 1|1-156:0| TM:NTM 1 TM:REGION 3->25| SEG 27->103|sgpaptthhststpvpashpsstaaaapstspapaptstssptaapatprpappspaqqpppppavapplpaapgps| HM:PFM:NREP 1 HM:PFM:REP 142->154|PF05901|9.9e-07|69.2|13/37|Excalibur| OP:NHOMO 15 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ------------------------21-----111113------1---------11---------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-156| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccc //