[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57775.1
DDBJ      :             putative ABC transporter
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  247/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.92.2
:351 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   86->341 2r7aB PDBj 6e-28 31.2 %
:RPS:PDB   106->344 1efdN PDBj 2e-36 15.7 %
:RPS:SCOP  106->344 1efdN  c.92.2.1 * 8e-37 15.7 %
:HMM:SCOP  86->349 1n2zA_ c.92.2.2 * 3.2e-40 28.3 %
:RPS:PFM   101->319 PF01497 * Peripla_BP_2 4e-12 32.4 %
:HMM:PFM   100->322 PF01497 * Peripla_BP_2 2.1e-34 24.9 221/238  
:BLT:SWISS 86->341 HMUT_YERPE 2e-35 36.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57775.1 GT:GENE BAD57775.1 GT:PRODUCT putative ABC transporter GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3109780..3110835) GB:FROM 3109780 GB:TO 3110835 GB:DIRECTION - GB:PRODUCT putative ABC transporter GB:PROTEIN_ID BAD57775.1 LENGTH 351 SQ:AASEQ MMVRDGVRSRSMRVLSMRVLLAALAVTLVAGVTACGGSDTADSGAGRGPATATLPDLDPVPVGPAPSPALPVTVRSFDGVEVTVTSADRIIAADRYGTLAQTVYALGLGDRLVGRSTSAAFPAVRDVPNVTGGSGSLNVESILALRPTVFLTDTTSAAPAVREQLRAAGVTVVYFDPQRTMAGVVPQIEAVAAALGVPAQGRALAQRTRQEIEAASAAVPAPDQPLRIAFLYLRSTAITMLAGPGSGADELITAIGGQDAGTAAGLTEPFTAITSEAMIGAAPDVVLVMTDGLESIGGVEGLLKVPGIAQTPAGRSKRIVDMSDAVLLSFGPNTGRVVEALSAAVYGTVPA GT:EXON 1|1-351:0| BL:SWS:NREP 1 BL:SWS:REP 86->341|HMUT_YERPE|2e-35|36.2|246/279| SEG 7->34|vrsrsmrvlsmrvllaalavtlvagvta| BL:PDB:NREP 1 BL:PDB:REP 86->341|2r7aB|6e-28|31.2|247/256| RP:PDB:NREP 1 RP:PDB:REP 106->344|1efdN|2e-36|15.7|235/262| RP:PFM:NREP 1 RP:PFM:REP 101->319|PF01497|4e-12|32.4|213/235|Peripla_BP_2| HM:PFM:NREP 1 HM:PFM:REP 100->322|PF01497|2.1e-34|24.9|221/238|Peripla_BP_2| GO:PFM:NREP 2 GO:PFM GO:0005381|"GO:iron ion transmembrane transporter activity"|PF01497|IPR002491| GO:PFM GO:0006827|"GO:high-affinity iron ion transport"|PF01497|IPR002491| RP:SCP:NREP 1 RP:SCP:REP 106->344|1efdN|8e-37|15.7|235/262|c.92.2.1| HM:SCP:REP 86->349|1n2zA_|3.2e-40|28.3|244/0|c.92.2.2|1/1|"Helical backbone" metal receptor| OP:NHOMO 300 OP:NHOMOORG 259 OP:PATTERN -------------------------11-11-------------1-111-1-------1-1-------- -----111222111----------------------1211-----1-----1-----1-----11---111-----------2----------------------1-11---------------------------211111121--------1------------1-----------------3111----11----------------11111---1111---------11------------------11-----------------------------------------------------------------------11-------1--------1111-----1---2----------211-----------11111-12---1111111----------1-------12111-1111111111111----111----11----------11---1------------------------------------1111-111111-111111--1111-11--1112--111121--211112----1-1-2-------------------------------1---------21-1---------------------------11-1---111--1---111------11--1------1------2-21111-111-111---1---111-1-111------11112111----------------1--1----1-322222222222--1------------1-1-----------1--1---------1--11111--1111111-------------1111222222111111----------------11-----------------------------------------1----------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 288 STR:RPRED 82.1 SQ:SECSTR ###########################################################cccEEEEccccEEEEEETTEEEEEETTcccEEEcccTHHHHHHHHHHHTTccccEEccHHcccccTTcEEcEcccccccHHHHHHHcccEEEEETTccccHHHHHHHccEEEEcccccccHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHGGGGcccccccEcEEEEEEETTEEEEEcTTcTTHHHHHHTTccccccccccTTcEEEEcGGGGGGccccEEEEEccccHHHHHHHHHHTcHHHHHcHHHHTTcEEEEccccTTccHHHHHHHHHHHHHHHHc#### DISOP:02AL 1-7, 35-59| PSIPRED ccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEEccccEEEEccccEEEEEEcccHHHHHHHHHcccccEEEEccccccHHHHHccccccccccccHHHHHHccccEEEEEcccccHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEccccEEEEEcccccHHHHHHHHcccccHHHcccccccccccHHHHHHHcccEEEEEccccccccHHHHHHHccHHHcccHHHcccEEEEcccccccccHHHHHHHHHHHHHHcccccc //