[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57779.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  56/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:194 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   6->175 PF11290 * DUF3090 2e-52 65.9 %
:HMM:PFM   6->175 PF11290 * DUF3090 2.7e-78 62.4 170/171  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57779.1 GT:GENE BAD57779.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3113816..3114400 GB:FROM 3113816 GB:TO 3114400 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57779.1 LENGTH 194 SQ:AASEQ MARAIHVFRTPDRFVAGTVGEPGDRAFYLQAVEQPRVVSVLLEKQQVKVLADRMGLLLDEVARRFGAPVPPQAEDVSDTDPLVTPIDAEFRVGTMGLGWDADAGAVVVELLAITETEVDESVVLDDTEEGPDAVRVFLTPVQAREFALRSAKVIAAGRPPCPLCGEPLSPRGHMCVRTNGYKRGEIFGAAELEE GT:EXON 1|1-194:0| RP:PFM:NREP 1 RP:PFM:REP 6->175|PF11290|2e-52|65.9|170/170|DUF3090| HM:PFM:NREP 1 HM:PFM:REP 6->175|PF11290|2.7e-78|62.4|170/171|DUF3090| OP:NHOMO 58 OP:NHOMOORG 56 OP:PATTERN -------------------------------------------------------------------- ---11---------11111-1111111111111111111112211----11-111-1---11111111111-----------------------------------------------------------------11111---11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 192-194| PSIPRED cccEEEEEcccccEEEEcccccccEEEEEEEEEccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHccccHHHHHEEEEEcccccccEEEEEEEccccccccHHHHHccccccccEEEEEEcHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEccccccc //